FAM32A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FAM32A Polyclonal antibody (19570-1-AP)

• 

  WB analysis using 19570-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 19570-1-AP (FAM32A antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of U2OS using 19570-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using FAM32A antibody (19570-1-AP) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

FAM32A Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 19570-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

CGI-144, OTAG12, OTAG-12, Ovarian tumor-associated gene 12, Protein FAM32A

---

Tested Applications

• Positive WB detected in: A2780 cells
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

19570-1-AP targets FAM32A in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13761

  Product name: Recombinant human FAM32A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-112 aa of BC000639

  Sequence: MEAYEQVQKGPLKLKGVAELGVTKRKKKKKDKDKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK

• Full Name: family with sequence similarity 32, member A
• Calculated Molecular Weight: 112 aa, 13 kDa
• Observed Molecular Weight: 13 kDa
• GenBank Accession Number: BC000639
• Gene Symbol: FAM32A
• Gene ID (NCBI): 26017
• RRID: AB_3741962
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y421
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM32A (family with sequence similarity 32 member) is also known as ovarian tumor associated gene-12 (OTAG-12, OTAG12) and its expression is suppressed in ovarian cancer. FAM32A is involved in increased cell proliferation and suppresses apoptosis (PMID: 21339736). FAM32A protein is a 13 kDa protein that consists of 112 amino acids and is predominantly located in the nucleus (PMID: 39730183).