Tested Applications
Positive WB detected in | A2780 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
19570-1-AP targets FAM32A in WB, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag13761 Product name: Recombinant human FAM32A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC000639 Sequence: MEAYEQVQKGPLKLKGVAELGVTKRKKKKKDKDKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK Predict reactive species |
Full Name | family with sequence similarity 32, member A |
Calculated Molecular Weight | 112 aa, 13 kDa |
Observed Molecular Weight | 13 kDa |
GenBank Accession Number | BC000639 |
Gene Symbol | FAM32A |
Gene ID (NCBI) | 26017 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9Y421 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FAM32A (family with sequence similarity 32 member) is also known as ovarian tumor associated gene-12 (OTAG-12, OTAG12) and its expression is suppressed in ovarian cancer. FAM32A is involved in increased cell proliferation and suppresses apoptosis (PMID: 21339736). FAM32A protein is a 13 kDa protein that consists of 112 amino acids and is predominantly located in the nucleus (PMID: 39730183).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for FAM32A antibody 19570-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |