Mouse FAM3D Recombinant monoclonal antibody, PBS Only (Detector)

• 

  WB analysis of mouse colon using 86090-1-RR (same clone as 86090-1-PBS)

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 86090-1-RR (FAM3D antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86090-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse stomach using 86090-1-RR (same clone as 86090-1-PBS)

  mouse stomach tissue were subjected to SDS PAGE followed by western blot with 86090-1-RR (FAM3D antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86090-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 86090-1-RR (same clone as 86090-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86090-1-RR (FAM3D antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86090-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP02761-1

  The mean FAM3D concentration was determined to be 2291.8 ng/mL in Mouse large intestine tissue extract based on a 4.5 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02761-1

  Cytometric bead array standard curve of MP02761-1, MOUSE FAM3D Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 86090-4-PBS. Detection antibody: 86090-1-PBS. Standard: Eg2694. Range: 0.312-40 ng/mL.

FAM3D Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 86090-1-PBS

Clone No.250561F4

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

Oit1, Oncoprotein-induced protein 1, Protein EF-7, Protein FAM3D

---

Product Information

86090-1-PBS targets FAM3D as part of a matched antibody pair:

MP02761-1: 86090-4-PBS capture and 86090-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2694

  Product name: recombinant mouse Oit1 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 26-223 aa of NM_146050.2

  Sequence: YTSFSRKTIRLPRWLGITPKDIQTPKSKCGLSKICPNNFFAFKISSGAANVVGPSMCFEDEIIMSPVRNNVGRGLNVALVNGSTGQVMKKDSFDMYSGDPQLLLNFLTEIPDSTLVLVASYDDPGTKMNDKIKTLFSNLGSSYAKQLGFRDSWVFVGAKDLKSKSPYEQFLKNNPETNKYDGWPELLELEGCVPRKVM

• Full Name: oncoprotein induced transcript 1
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: NM_146050.2
• Gene Symbol: Oit1
• Gene ID (NCBI): 18300
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P97805
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FAM3D (family with sequence similarity 3, member D) is a protein that belongs to the FAM3 family, which is a novel cytokine-like gene family identified in 2002. This family comprises four members: FAM3A, FAM3B, FAM3C, and FAM3D. FAM3D is a gut-secreted protein that is regulated by nutritional status. It has a predicted secondary structure of a four-helix bundle, which is a common feature in many other cytokines.