FAM50B Polyclonal antibody

• 

  WB analysis using 32562-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32562-1-AP (FAM50B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 32562-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32562-1-AP (FAM50B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

FAM50B Polyclonal Antibody for WB, ELISA

Cat No. 32562-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Protein FAM50B, Protein XAP-5-like, X5L

---

Tested Applications

• Positive WB detected in: MCF-7 cells, MDA-MB-231 cells, U-87 MG cells, SK-BR-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32562-1-AP targets FAM50B in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38226

  Product name: Recombinant human FAM50B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 73-141 aa of NM_012135.2

  Sequence: MKARQEALVRERERQLAKRQHLEEQRLQQERQREQEQRRERKRKISCLSFALDDLDDQADAAEARRAGN

• Full Name: family with sequence similarity 50, member B
• Calculated Molecular Weight: 39kDa，325aa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: NM_012135.2
• Gene Symbol: FAM50B
• Gene ID (NCBI): 26240
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9Y247
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM50B, also known as family with sequence similarity 50, member B, is a protein-coding gene located on chromosome 6. It is widely expressed in various tissues, with particularly high abundance in the testis and both adult and fetal brain. The exact function of FAM50B is not yet fully understood and is still under investigation.