FAM71F1 Polyclonal antibody

• 

  WB analysis of A549 using 27984-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 27984-1-AP (FAM71F1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

FAM71F1 Polyclonal Antibody for WB, ELISA

Cat No. 27984-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, ELISA

Synonyms

FAM137A, FAM71F1, NYD SP18, Protein FAM137A, Protein FAM71F1

---

Tested Applications

• Positive WB detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27984-1-AP targets FAM71F1 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16525

  Product name: Recombinant human FAM71F1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 220-342 aa of BC037248

  Sequence: NCSSPSGDSKLVQKKLQASQPSESLIQLMTKGESEALSQIFADLHQQNQLRSSRKVETNKNSSGKDSSREDSIPCTCDLRWRASFTYGEWERENPSGLQPLSLLSTLAASTGPQLAPPIGNSI

• Full Name: family with sequence similarity 71, member F1
• Calculated Molecular Weight: 342 aa, 39 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC037248
• Gene Symbol: FAM71F1
• Gene ID (NCBI): 84691
• RRID: AB_2881030
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96KD3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM71F1, also named GARIN1B and FAM137A, belongs to the GARIN family. FAM71F1 is a testis-enriched protein containing a RAB2B-binding domain, a small GTPase involved in vesicle transport and membrane trafficking (PMID: 34714330).