FAM72A Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87597-1-RR (same clone as 87597-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87597-1-RR (FAM72A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87597-1-PBS in a different storage buffer formulation.

• 

  Affinity of 87597-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87597-1-RR against Human FAM72A were performed. The affinity constant is below 1 pM.

FAM72A Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87597-1-PBS

Clone No.252899H6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

FAM72, Latent membrane protein 1-induced protein, LMP1-induced protein, LMPIP, Protein FAM72A

---

Product Information

87597-1-PBS targets FAM72A in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag15566

  Product name: Recombinant human FAM72A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-149 aa of BC035696

  Sequence: MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFTKICKCKLKDIACLKCGNIVGYHVIVPCSSCLLSCNNGHFWMFHSQAVYDINRLDSTGVNVLLWGNLPEIEESTDEDVLNISAEECIR

• Full Name: family with sequence similarity 72, member A
• Calculated Molecular Weight: 149 aa, 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC035696
• Gene Symbol: FAM72
• Gene ID (NCBI): 729533
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q5TYM5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FAM72A, also named as LMIP and UGENE, is a mitochondrial protein which regulates cellular reactive oxygen species metabolism. It's up-regulated in malignant colon cancers, compared to normal colon and colon adenomas. FAM72 has some members A/B/C/D with higher homology. This antibody detects all the members of FAM72.