FAM76A Polyclonal antibody

• 

  WB analysis using 20863-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20863-1-AP (FAM76A antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 20863-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 20863-1-AP (FAM76A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 20863-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 20863-1-AP (FAM76A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 20863-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 20863-1-AP (FAM76A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

FAM76A Polyclonal Antibody for WB, IHC, ELISA

Cat No. 20863-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

FAM76A, Protein FAM76A

---

Tested Applications

• Positive WB detected in: COLO 320 cells, HeLa cells, Jurkat cells
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20863-1-AP targets FAM76A in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14904

  Product name: Recombinant human FAM76A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 142-227 aa of BC025768

  Sequence: QRKHLSSSSRAGHQEKEQYSRLSGGGHYNSQKTLSTSSIQNEIPKKKSKFESITTNGDSFSPDLALDSPGTDHFVIIAQLKEEVAT

• Full Name: family with sequence similarity 76, member A
• Calculated Molecular Weight: 307 aa, 35 kDa
• Observed Molecular Weight: 35-38 kDa
• GenBank Accession Number: BC025768
• Gene Symbol: FAM76A
• Gene ID (NCBI): 199870
• RRID: AB_10693681
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TAV0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM76A is a member of FAM76 family. It is reported that FAM76A may be regulated by WTAP. FAM76A is highly expressed in the WTAP high-expression group and also expressed at low levels in the WTAP low-expression group, which can be confirmed by TCGA data (PMID: 32998774).