FAM83B Polyclonal antibody

• 

  WB analysis using 26032-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 26032-1-AP (FAM83B antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human brown disease using 26032-1-AP

  Immunohistochemical analysis of paraffin-embedded human brown disease slide using 26032-1-AP (FAM83B antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human brown disease using 26032-1-AP

  Immunohistochemical analysis of paraffin-embedded human brown disease slide using 26032-1-AP (FAM83B antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

FAM83B Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26032-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

C6orf143

---

Tested Applications

• Positive WB detected in: MCF-7 cells
• Positive IHC detected in: human brown disease; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26032-1-AP targets FAM83B in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22951

  Product name: Recombinant human FAM83B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 653-1011 aa of BC112275

  Sequence: NQQTENLLKRRSFPLFDNSKANLDPGNSKHYVYSTLTRNRVRQPEKPKEDLLKSSKSMHNVTHNLEEDEEEVTKRNSPSGTTTKSVSIAALLDVNKEESNKELASKKEVKGSPSFLKKGSQKLRSLLSLTPDKKENLSKNKAPAFYRLCSSSDTLVSEGEENQKPKKSDTKVDSSPRRKHSSSSNSQGSIHKSKEDVTVSPSQEINAPPDENKRTPSPGPVESKFLERAGDASAPRFNTEQIQYRDSREINAVVNPERRPTSSPRPTSSELLRSHSTDRRVYSRFEPFCKIESSIQPTSNMPNTSINRPEIKSATMGNSYGRSSPLLNYNTGVYRSYQPNENKFRGFMQKFGNFIHKNK

• Full Name: family with sequence similarity 83, member B
• Calculated Molecular Weight: 1011 aa, 115 kDa
• Observed Molecular Weight: 115 kDa
• GenBank Accession Number: BC112275
• Gene Symbol: FAM83B
• Gene ID (NCBI): 222584
• RRID: AB_3085837
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5T0W9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM83B, also known as C6orf143, belongs to the FAM83 family. FAM83B is an oncogene and promotes cell transformation through activating various pathway in different kinds of tumors. FAM83B over expressed in several kinds of malignant tumors, such as breast cancer, cervical cancer, endometrial cancer, pancreatic ductal adenocarcinoma, etc. Overexpression of FAM83B could promote the malignant biological behaviors of these tumors (PMID: 33423038, 36690987). The calculated molecular weight of FAM83B is 115 kDa.