FANCL Monoclonal antibody

• 

  WB analysis of HeLa using 66639-1-Ig

  HeLa cells and HEK-293 cells were subjected to SDS PAGE followed by western blot with 66639-1-Ig (FANCL antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 66639-1-Ig

  WB result of FANCL antibody (66639-1-Ig; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-FANCL transfected HEK-293 cells.

• 

  IF Staining of HeLa using 66639-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using FANCL antibody (66639-1-Ig, Clone: 6E2B6 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

• Featured Product
• KD/KO Validated

FANCL Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 66639-1-Ig

Clone No.6E2B6

Publications(4)

Host / Isotype

Mouse / IgG2a

Reactivity

Human and More (2)

Applications

WB, IF/ICC, ELISA

Synonyms

FAAP43, FANCL, Fanconi anemia group L protein, PHF9, POG

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:3000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 4 publications below

Product Information

66639-1-Ig targets FANCL in WB, IF/ICC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6192

  Product name: Recombinant human FANCL protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-375 aa of BC054517

  Sequence: MAVTEASLLRQCPLLLPQNRSKTVYEGFISAQGRDFHLRIVLPEDLQLKNARLLCSWQLRTILSGYHRIVQQRMQHSPDLMSFMMELKMLLEVALKNRQELYALPPPPQFYSSLIEEIGTLGWDKLVYADTCFSTIKLKAEDASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQSSLISIYSQFLAAIESLKAFWDVMDEIDEKTWVLEPEKPPRSATARRIALGNNVSINIEVDPRHPTMLPECFFLGADHVVKPLGIKLSRNIHLWDPENSVLQNLKDVLEIDFPARAILEKSDFTMDCGICYAYQLDGTIPDQVCDNSQCGQPFHQICLYEWLRGLLTSRQSFNIIFGECPYCSKPITLKMSGRKH

• Full Name: Fanconi anemia, complementation group L
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 41-43 kDa
• GenBank Accession Number: BC054517
• Gene Symbol: FANCL
• Gene ID (NCBI): 55120
• RRID: AB_2881998
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NW38
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fanconi anemia (FA) is a hereditary bone marrow failure syndrome associated with developmental defects and cancer predisposition. The FA nuclear core complex consists of FANCA, B, C, E, F, G, L, and M. FANCL is a RING-type E3 ubiquitin ligase that monoubiquitinates FANCD2 and FANCI, a key functional role facilitated by other members of the nuclear core complex (PMID: 23783032). FANCL plays an important role in the repair of cisplatin-induced DNA damage (PMID: 26385482) and participates directly in support of stem cell function (PMID: 23783032). FANCL can be detected as 40-43 kDa (full-length) and ~28 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Nat Struct Mol Biol; Fanconi anemia proteins participate in a break-induced-replication-like pathway to counter replication stress.; Authors - Xinlin Xu ; KO Validated
human	WB	J Mol Biol; Mitotic DNA synthesis in untransformed human cells preserves common fragile site stability via a FANCD2-driven mechanism that requires HELQ; Authors - Emma L Traband ; KO Validated
human	WB	Cell Rep; FANCD2-dependent mitotic DNA synthesis relies on PCNA K164 ubiquitination; Authors - Wendy Leung ; KO Validated
mouse,human	WB	Nat Commun; Histone-methyltransferase KMT2D deficiency impairs the Fanconi anemia/BRCA pathway upon glycolytic inhibition in squamous cell carcinoma; Authors - Wei Liu