FANCL Monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 66639-1-Ig (same clone as 66639-1-PBS)

  HeLa cells and HEK-293 cells were subjected to SDS PAGE followed by western blot with 66639-1-Ig (FANCL antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66639-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66639-1-Ig (same clone as 66639-1-PBS)

  WB result of FANCL antibody (66639-1-Ig; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-FANCL transfected HEK-293 cells. This data was developed using the same antibody clone with 66639-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66639-1-Ig (same clone as 66639-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using FANCL antibody (66639-1-Ig, Clone: 6E2B6 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66639-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

FANCL Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 66639-1-PBS

Clone No.6E2B6

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

FAAP43, FANCL, Fanconi anemia group L protein, PHF9, POG

---

Product Information

66639-1-PBS targets FANCL in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6192

  Product name: Recombinant human FANCL protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-375 aa of BC054517

  Sequence: MAVTEASLLRQCPLLLPQNRSKTVYEGFISAQGRDFHLRIVLPEDLQLKNARLLCSWQLRTILSGYHRIVQQRMQHSPDLMSFMMELKMLLEVALKNRQELYALPPPPQFYSSLIEEIGTLGWDKLVYADTCFSTIKLKAEDASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQSSLISIYSQFLAAIESLKAFWDVMDEIDEKTWVLEPEKPPRSATARRIALGNNVSINIEVDPRHPTMLPECFFLGADHVVKPLGIKLSRNIHLWDPENSVLQNLKDVLEIDFPARAILEKSDFTMDCGICYAYQLDGTIPDQVCDNSQCGQPFHQICLYEWLRGLLTSRQSFNIIFGECPYCSKPITLKMSGRKH

• Full Name: Fanconi anemia, complementation group L
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 41-43 kDa
• GenBank Accession Number: BC054517
• Gene Symbol: FANCL
• Gene ID (NCBI): 55120
• RRID: AB_2881998
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NW38
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Fanconi anemia (FA) is a hereditary bone marrow failure syndrome associated with developmental defects and cancer predisposition. The FA nuclear core complex consists of FANCA, B, C, E, F, G, L, and M. FANCL is a RING-type E3 ubiquitin ligase that monoubiquitinates FANCD2 and FANCI, a key functional role facilitated by other members of the nuclear core complex (PMID: 23783032). FANCL plays an important role in the repair of cisplatin-induced DNA damage (PMID: 26385482) and participates directly in support of stem cell function (PMID: 23783032). FANCL can be detected as 40-43 kDa (full-length) and ~28 kDa.