Fas/CD95 Polyclonal antibody

• 

  WB analysis of Jurkat using 13098-1-AP

  WB result of FAS/CD95 antibody (13098-1-AP, 1:1000) with si-control and si-FAS transfected Jurkat cells.

• 

  WB analysis using 13098-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13098-1-AP (FAS/CD95 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 13098-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13098-1-AP (FAS/CD95 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 13098-1-AP

  IP result of anti-FAS/CD95 (IP:13098-1-AP, 3ug; Detection:13098-1-AP 1:500) with HeLa cells lysate 3000ug.

• Featured Product
• KD/KO Validated

Fas/CD95 Polyclonal Antibody for WB, IP, ELISA

Cat No. 13098-1-AP

Publications(134)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF, IP, CoIP, CHIP, ELISA

Synonyms

FAS, ALPS1A, APO-1, Apo-1 antigen, Apoptosis-mediating surface antigen FAS

---

Tested Applications

• Positive WB detected in: HT-1080 cells, HT-29 cells, Jurkat cells, HeLa cells
• Positive IP detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 123 publications below
• IHC: See 12 publications below
• IF: See 8 publications below
• IP: See 2 publications below
• CoIP: See 2 publications below
• ChIP: See 1 publications below

Product Information

13098-1-AP targets Fas/CD95 in WB, IHC, IF, IP, CoIP, CHIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, monkey, hamster, sheep
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3718

  Product name: Recombinant human FAS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 156-335 aa of BC012479

  Sequence: ECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV

• Full Name: Fas (TNF receptor superfamily, member 6)
• Calculated Molecular Weight: 35-38 kDa
• Observed Molecular Weight: 38-45 kDa
• GenBank Accession Number: BC012479
• Gene Symbol: Fas/CD95
• Gene ID (NCBI): 355
• RRID: AB_2278042
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P25445
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fas (CD95/APO-1) is a transmembrane glycoprotein belonging to the tumor necrosis factor (TNF) receptor superfamily. It can mediate apoptosis by ligation with an agonistic anti-Fas antibody or Fas ligand. Stimulation of Fas results in the aggregation of its intracellular death domains, leading to the formation of the death-inducing signaling complex (DISC). FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The molecular mass of native Fas is 38 kDa, the high molecular weight form (40-55 kDa) of Fas is due to glycosylation.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Cell; Neutrophil elastase selectively kills cancer cells and attenuates tumorigenesis.; Authors - Chang Cui
human	WB,IP,IF	Nat Commun; A neutrophil mimicking metal-porphyrin-based nanodevice loaded with porcine pancreatic elastase for cancer therapy; Authors - Tingting Cui
human	WB	Cell Res; DNA damage triggers tubular endoplasmic reticulum extension to promote apoptosis by facilitating ER-mitochondria signaling.; Authors - Pengli Zheng
human	WB	Clin Transl Med; c-Myb facilitates immune escape of esophageal adenocarcinoma cells through the miR-145-5p/SPOP/PD-L1 axis.; Authors - Lan Zhang
	WB	Phytomedicine; Garlic-derived exosomes regulate PFKFB3 expression to relieve liver dysfunction in high-fat diet-fed mice via macrophage-hepatocyte crosstalk; Authors - Jinfan Liu
	WB,IF	Phytomedicine; Wen-Shen-Jian-Pi-Hua-Tan decoction protects against early obesity-related glomerulopathy by improving renal bile acid composition and suppressing lipogenesis, inflammation, and fibrosis; Authors - Daofei Song

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Macarena Lucia (Verified Customer) (11-16-2021)

Some unspecific binding but the target is very easy to identify.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: ovarian ca cell lines / melanoma cell lines

FH

Kishor (Verified Customer) (06-23-2019)

This antibody works good at 1:1000 dilution in WB for mouse and human cells.

• Applications: Western Blot, Immunofluorescence,
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Human and mouse cell lines

Fas/CD95 Antibody Western Blot,Immunofluorescence, validation (1:1000 dilution) in Human and mouse cell lines (Cat no:13098-1-AP)