FAT1 Polyclonal antibody

FAT1 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 30733-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

CDHF7, FAT, hFat1, ME5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, Jurkat cells
Positive IHC detected inhuman prostate hyperplasia tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:5000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

30733-1-AP targets FAT1 in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag33957

Product name: Recombinant human FAT1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 4390-4550 aa of

Sequence: PSVPLPDIQEFPNYEVIDEQTPLYSADPNAIDTDYYPGGYDIESDFPPPPEDFPAADELPPLPPEFSNQFESIHPPRDMPAAGSLGSSSRNRQRFNLNQYLPNFYPLDMSEPQTKGTGENSTCREPHAPYPPGYQRHFEAPAVESMPMSVYASTASCSDVS

Predict reactive species
Full Name FAT tumor suppressor homolog 1 (Drosophila)
Observed Molecular Weight506-600 kDa, 85 kDa
Gene Symbol FAT1
Gene ID (NCBI) 2195
RRIDAB_3086406
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ14517
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAT1, also known as hFat1, belongs to a member of the cadherin superfamily, has been proposed to play roles in cerebral development, glomerular slit formation, and also to act as a tumor suppressor, but its mechanisms of action have not been elucidated. It is expected to be located in cell membrane and nucleus, which is expressed in many epithelial and some endothelial and smooth muscle cells. The calculated molecular weight of FAT1 is 506 kDa and there is glycosylation modification of the protein. To examine functions of the transmembrane and cytoplasmic domains, they were expressed in HEK-293 and HeLa cells as chimeric proteins in fusion with EGFP and extracellular domains derived from E-cadherin. Proteins comprising the transmembrane domain localized to the membrane fraction (PMID: 15922730, 26373379).The high molecular mass band observed at the expected 500-kDa size of FAT1 is indicated by an arrow together with a prominent band at 85 kDa (PMID: 21680732).

Protocols

Product Specific Protocols
IHC protocol for FAT1 antibody 30733-1-APDownload protocol
WB protocol for FAT1 antibody 30733-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...