FBP17 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86852-2-RR (same clone as 86852-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86852-2-RR (FNBP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86852-2-PBS in a different storage buffer formulation.

• 

  IF Staining of Jurkat using 86852-2-RR (same clone as 86852-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using FBP17 antibody (86852-2-RR, Clone: 251876G12 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86852-2-PBS in a different storage buffer formulation.

FBP17 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86852-2-PBS

Clone No.251876G12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

FNBP1, Formin-binding protein 1, Formin-binding protein 17

---

Product Information

86852-2-PBS targets FBP17 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25784

  Product name: Recombinant human FNBP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 176-241 aa of BC101755

  Sequence: AQIRHQMAEDSKADYSSILQKFNHEQHEYYHTHIPNIFQKIQEMEERRIVRMGESMKTYAEVDRQV

• Full Name: formin binding protein 1
• Observed Molecular Weight: 80-85 kDa
• GenBank Accession Number: BC101755
• Gene Symbol: FBP17
• Gene ID (NCBI): 23048
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96RU3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FBP17 (formin-binding protein 17) is a new dynamin-associating molecule consisting of several functional domains, including an N-terminal EFC domain and an SH3 domain at the C-terminus. FBP17 is involved in dynamin-mediated endocytosis and has been reported to be required for invadopodia formation and tumor cell invasion.