FBXO32 Polyclonal antibody, PBS Only

• 

  IHC staining of mouse skeletal muscle using 28541-1-AP (same clone as 28541-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 28541-1-AP (FBXO32 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28541-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 28541-1-AP (same clone as 28541-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 28541-1-AP (FBXO32 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28541-1-PBS in a different storage buffer formulation.

FBXO32 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 28541-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

28541-1-PBS targets FBXO32 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29410

  Product name: Recombinant human FBXO32 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 50-120 aa of BC024030

  Sequence: MWVYRMETILHWQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLL

• Full Name: F-box protein 32
• Calculated Molecular Weight: 355 aa, 42 kDa
• GenBank Accession Number: BC024030
• Gene Symbol: FBXO32
• Gene ID (NCBI): 114907
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q969P5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FBXO32 (F box only protein 32), also known as Atrogin 1 or MAFbx, is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif F-box. This protein is an E3 ubiquitin ligase that is markedly up-regulated in muscle atrophy. FBXO32 is thus a potential drug target for the treatment of muscle atrophy. Some data support that FBXO32 may play an important role in tumorigenesis. Recent study reveal that FBXO32 targets the oncogenic protein c-Myc for ubiquitination and degradation through the proteasome pathway.