FBXO33 Polyclonal antibody, PBS Only

• 

  WB analysis using 23381-1-AP (same clone as 23381-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 23381-1-AP (FBXO33 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23381-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 23381-1-AP (same clone as 23381-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using FBXO33 antibody (23381-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 23381-1-PBS in a different storage buffer formulation.

FBXO33 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 23381-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

FBX33, F-box only protein 33, c14_5247, BMND12

---

Product Information

23381-1-PBS targets FBXO33 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20055

  Product name: Recombinant human FBXO33 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 210-555 aa of BC068566

  Sequence: DISVLQQQGSLSNTYLSKVDPDGKKIKQIQQLFEEILSNSRQLKWLSCGFMLEIVTPTSLSSLSNAVANTMEHLSLLDNNIPGNSTLITAVELERFVNLHSLALDFCDFTAEMARVLTDSNHVPLQRLSLLVHNVSVMHKSLDNMPNDEHWKALSRKSTSFRVYIMAFDIKSEDMLKILKPSIPLERIHFDSYITCVSGAIVDLISRQYDKFLTHFILMNDVIDTSGFPDLSDNRNEDPLVLLAWRCTKLSLLAIHGYTVWAHNLIAIARLRGSDLKVLEVTEESIDFDQGELADQDVDPVHNLIEQVSLGLGQPWHAVMDIESLSVFTEPNRHFYREMQSFSEDI

• Full Name: F-box protein 33
• Calculated Molecular Weight: 555 aa, 63 kDa
• Observed Molecular Weight: 63 kDa
• GenBank Accession Number: BC068566
• Gene Symbol: FBXO33
• Gene ID (NCBI): 254170
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z6M2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

F-box Only Protein 33 (FBXO33) is a typical member of the F-box protein family with E3 ligase function. FBXO33 can regulate the ubiquitination and solubility of polyglutamine disease proteins, potentially serving as a target for treating type 3 spinocerebellar ataxia. FBXO33 ligase interferes with YB-1-mediated functions by binding and ubiquitinating the multifunctional regulator Y-box-binding protein 1 (YB-1)/dbpB/p50, leading to proteasomal degradation (PMID: 39206900). The calculated molecular weight of FBXO33 is 63 kDa.