FCRLA Polyclonal antibody

FCRLA Polyclonal Antibody for WB, IHC, ELISA
Cat No. 26949-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

FCRL, Fc receptor-related protein X, Fc receptor-like protein, Fc receptor-like and mucin-like protein 1, Fc receptor-like A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRaji cells, Daudi cells
Positive IHC detected inhuman tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IHCSee 1 publications below

Product Information

26949-1-AP targets FCRLA in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25331

Product name: Recombinant human FCRLA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 275-376 aa of BC006521

Sequence: IRVQGASSSAAPPTLNPAPQKSAAPGTAPEEAPGPLPPPPTPSSEDPGFSSPLGMPDPHLYHQMGLLLKHMQDVRVLLGHLLMELRELSGHQKPGTTKATAE

Predict reactive species
Full Name Fc receptor-like A
Calculated Molecular Weight 39 kDa
Observed Molecular Weight 39-43 kDa
GenBank Accession NumberBC006521
Gene Symbol FCRLA
Gene ID (NCBI) 84824
RRIDAB_2880697
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ7L513
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for FCRLA antibody 26949-1-APDownload protocol
WB protocol for FCRLA antibody 26949-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Int J Cancer

Aggressive characteristics of tumor deposits in colorectal cancer highlight the need for staging refinement in patients with 0-3 metastatic lymph nodes

Authors - Xi'e Hu
Loading...
||
New chat Able
正在加载,请稍候...