Tested Applications
Positive WB detected in | Raji cells, Daudi cells |
Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:16000 |
Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
IHC | See 1 publications below |
Product Information
26949-1-AP targets FCRLA in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25331 Product name: Recombinant human FCRLA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 275-376 aa of BC006521 Sequence: IRVQGASSSAAPPTLNPAPQKSAAPGTAPEEAPGPLPPPPTPSSEDPGFSSPLGMPDPHLYHQMGLLLKHMQDVRVLLGHLLMELRELSGHQKPGTTKATAE Predict reactive species |
Full Name | Fc receptor-like A |
Calculated Molecular Weight | 39 kDa |
Observed Molecular Weight | 39-43 kDa |
GenBank Accession Number | BC006521 |
Gene Symbol | FCRLA |
Gene ID (NCBI) | 84824 |
RRID | AB_2880697 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q7L513 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for FCRLA antibody 26949-1-AP | Download protocol |
IHC protocol for FCRLA antibody 26949-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |