FGF2 Polyclonal antibody, PBS Only

• 

  WB analysis using 30333-1-AP (same clone as 30333-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30333-1-AP (FGF2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30333-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SKOV-3 using 30333-1-AP (same clone as 30333-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed SKOV-3 cells using FGF-2 antibody (30333-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red). This data was developed using the same antibody clone with 30333-1-PBS in a different storage buffer formulation.

FGF2 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 30333-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

FGF-2, fibroblast growth factor 2, FGFB, FGF basic, FGF B

---

Product Information

30333-1-PBS targets FGF2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28653

  Product name: Recombinant human FGF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 143-275 aa of NM_002006

  Sequence: MPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPG

• Full Name: fibroblast growth factor 2 (basic)
• Calculated Molecular Weight: 31 aa
• Observed Molecular Weight: 21 kDa，23 kDa
• GenBank Accession Number: NM_002006
• Gene Symbol: FGF2
• Gene ID (NCBI): 2247
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P09038
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Fibroblast growth factor-2 (FGF-2), also referred to as basic FGF, belongs to a family of growth factors that stimulate proliferation of cells of mesenchymal, epithelial and neuroectodermal origin. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in at least five different isoforms with distinct properties.