FGF1 Polyclonal antibody

• 

  WB analysis using 17400-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17400-1-AP (FGF1 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 17400-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17400-1-AP (FGF1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse spinal cord using 17400-1-AP

  mouse spinal cord tissue were subjected to SDS PAGE followed by western blot with 17400-1-AP (FGF1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 17400-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 17400-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 17400-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 10x lens).

• 

  IHC staining of human breast cancer using 17400-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 40x lens).

• 

  IHC staining of human lung cancer using 17400-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 17400-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 17400-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 17400-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 17400-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 17400-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat kidney using 17400-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat kidney using 17400-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 17400-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using FGF1 antibody (17400-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

FGF1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 17400-1-AP

Publications(8)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

FGF-1, Endothelial cell growth factor, Fibroblast growth factor 1, HBGF-1, Heparin-binding growth factor 1

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse spinal cord tissue, mouse heart tissue, rat heart tissue, rat brain tissue
• Positive IHC detected in: human colon cancer tissue, human breast cancer tissue, human lung cancer tissue, mouse brain tissue, rat brain tissue, rat kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 8 publications below
• IF: See 2 publications below

Product Information

17400-1-AP targets FGF1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11366

  Product name: Recombinant human FGF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-155 aa of BC032697

  Sequence: MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

• Full Name: fibroblast growth factor 1 (acidic)
• Calculated Molecular Weight: 155 aa, 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC032697
• Gene Symbol: FGF1
• Gene ID (NCBI): 2246
• RRID: AB_2103758
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P05230
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Neuropharmacology; Non-mitogenic fibroblast growth factor 1 protects against ischemic stroke by regulating microglia/macrophage polarization through Nrf2 and NF-κB pathways.; Authors - Confidence Dordoe
human	WB	Life Sci; A derivant of ginsenoside CK and its inhibitory effect on hepatocellular carcinoma.; Authors - Jingjing Zhang
pig	WB	Physiol Rep; Sitagliptin therapy improves myocardial perfusion and arteriolar collateralization in chronically ischemic myocardium: A pilot study; Authors - Sharif A Sabe
mouse	WB	J Cereb Blood Flow Metab; Saturated fatty acids stimulate cytokine production in tanycytes via the PP2Ac-dependent signaling pathway; Authors - Danyang Liu
mouse	WB,IF	Adv Sci (Weinh); Hepatocyte-Derived FGF1 Alleviates Isoniazid and Rifampicin-Induced Liver Injury by Regulating HNF4α-Mediated Bile Acids Synthesis; Authors - Qian Lin ; KO Validated
mouse	WB	Acta Pharmacol Sin; Madecassoside mitigates acute myocardial infarction injury by activating the PKCB/SPARC signaling pathway; Authors - Peng Wang