FGFR1OP Polyclonal antibody, PBS Only

• 

  WB analysis using 11343-1-AP (same clone as 11343-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11343-1-AP (FGFR1OP antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11343-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 11343-1-AP (same clone as 11343-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 11343-1-AP (FGFR1OP Antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11343-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U-937 using 11343-1-AP (same clone as 11343-1-PBS)

  U-937 cells were subjected to SDS PAGE followed by western blot with 11343-1-AP (FGFR1OP Antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11343-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 11343-1-AP (same clone as 11343-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 11343-1-AP (FGFR1OP antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11343-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 11343-1-AP (same clone as 11343-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma using 11343-1-AP (FGFR1OP antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11343-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 11343-1-AP (same clone as 11343-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using FGFR1OP antibody (11343-1-AP) at dilution of 1:100 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11343-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 11343-1-AP (same clone as 11343-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using FGFR1OP antibody (11343-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11343-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

FGFR1OP Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 11343-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

FOP, FGFR1 oncogene partner, CEP43, Centrosomal protein 43

---

Product Information

11343-1-PBS targets FGFR1OP in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1891

  Product name: Recombinant human FGFR1OP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-374 aa of BC011902

  Sequence: MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNESLRKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAEGTVGGPLLLEVIRRCQQKEKGPTTGEGALDLSDVHSPPKSPEGKTSAQTTPSKKANDEANQSDTSVSLSEPKSKSSLHLLSHETKIGSFLSNRTLDGKDKAGLCPDEDDMEGDSFFDDPIPKPEKTYGLRNEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVLKDLKLISDKIGSLGLGTGEDDDYVDDFNSTSHRSEKSEISIGEEIEEDLSVEIDDINTSDKLDDLTQDLTVSQLSDVADY

• Full Name: FGFR1 oncogene partner
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC011902
• Gene Symbol: FGFR1OP
• Gene ID (NCBI): 11116
• RRID: AB_2103362
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95684
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The fibroblast growth factor receptor 1 oncogene partner (FGFR1OP), FOP, is a centrosomal protein that is involved in the anchoring of microtubules to subcellular structures. Three isoforms have been produced by alternative splicing. A chromosomal aberration involving FGFR1OP may be a cause of stem cell myeloproliferative disorder (MPD). MPD is characterized by myeloid hyperplasia, eosinophilia and T-cell or B-cell lymphoblastic lymphoma and progresses to acute myeloid leukemia.