FGFR1OP Polyclonal antibody

• 

  WB analysis using 11343-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11343-1-AP (FGFR1OP antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 11343-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 11343-1-AP (FGFR1OP Antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 11343-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 11343-1-AP (FGFR1OP antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of U-937 using 11343-1-AP

  U-937 cells were subjected to SDS PAGE followed by western blot with 11343-1-AP (FGFR1OP Antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lymphoma using 11343-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma using 11343-1-AP (FGFR1OP antibody) at dilution of 1:50 (under 10x lens).

• 

  IF Staining of HeLa using 11343-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using FGFR1OP antibody (11343-1-AP) at dilution of 1:100 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of HEK-293 using 11343-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using FGFR1OP antibody (11343-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

FGFR1OP Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11343-1-AP

Publications(21)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

FOP, FGFR1 oncogene partner, CEP43, Centrosomal protein 43

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse heart tissue, U-937 cells, HL-60 cells, MCF-7 cells, HeLa cells
• Positive IHC detected in: human lymphoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells, HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 6 publications below
• IHC: See 1 publications below
• IF: See 15 publications below

Product Information

11343-1-AP targets FGFR1OP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1891

  Product name: Recombinant human FGFR1OP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-374 aa of BC011902

  Sequence: MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNESLRKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAEGTVGGPLLLEVIRRCQQKEKGPTTGEGALDLSDVHSPPKSPEGKTSAQTTPSKKANDEANQSDTSVSLSEPKSKSSLHLLSHETKIGSFLSNRTLDGKDKAGLCPDEDDMEGDSFFDDPIPKPEKTYGLRNEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVLKDLKLISDKIGSLGLGTGEDDDYVDDFNSTSHRSEKSEISIGEEIEEDLSVEIDDINTSDKLDDLTQDLTVSQLSDVADY

• Full Name: FGFR1 oncogene partner
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC011902
• Gene Symbol: FGFR1OP
• Gene ID (NCBI): 11116
• RRID: AB_2103362
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95684
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The fibroblast growth factor receptor 1 oncogene partner (FGFR1OP), FOP, is a centrosomal protein that is involved in the anchoring of microtubules to subcellular structures. Three isoforms have been produced by alternative splicing. A chromosomal aberration involving FGFR1OP may be a cause of stem cell myeloproliferative disorder (MPD). MPD is characterized by myeloid hyperplasia, eosinophilia and T-cell or B-cell lymphoblastic lymphoma and progresses to acute myeloid leukemia.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
zebrafish	IF	Cell; Vertebrate cells differentially interpret ciliary and extraciliary cAMP.; Authors - Melissa E Truong
human	WB,IF	Nat Commun; Microtubule asters anchored by FSD1 control axoneme assembly and ciliogenesis.; Authors - Hai-Qing Tu ; KD Validated
mouse	IF	Dev Cell; Endoderm development requires centrioles to restrain p53-mediated apoptosis in the absence of ERK activity.; Authors - Chang Xie
human	WB	Dev Cell; The CEP19-RABL2 GTPase Complex Binds IFT-B to Initiate Intraflagellar Transport at the Ciliary Base.; Authors - Tomoharu Kanie
human	IF	J Cell Biol; A ciliopathy complex builds distal appendages to initiate ciliogenesis.; Authors - Dhivya Kumar
human,mouse	IF	Elife; Centriolar satellites expedite mother centriole remodeling to promote ciliogenesis; Authors - Emma A Hall