FGR Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 83352-2-PBS

  Biolayer interferometry (BLl) kinetic assay of 83352-2-PBS against Human FGR was performed. The affinity constant is 0.291 nM.

FGR Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83352-2-PBS

Clone No.240275G6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

c fgr, c src2, p55 Fgr, p55c fgr, p58c fgr

---

Product Information

83352-2-PBS targets FGR in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34944

  Product name: Recombinant human FGR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-90 aa of NM_005248

  Sequence: MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVSGIGVTLFIALYDYEA

• Full Name: Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog
• Calculated Molecular Weight: 59 kDa
• GenBank Accession Number: NM_005248
• Gene Symbol: FGR
• Gene ID (NCBI): 2268
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P09769
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.