FHL3 Monoclonal antibody

• 

  WB analysis using 60966-4-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 60966-4-Ig (FHL3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Mo7e using 60966-4-Ig

  Mo7e cells were subjected to SDS PAGE followed by western blot with 60966-4-Ig (FHL3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 60966-4-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 60966-4-Ig (FHL3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

FHL3 Monoclonal Antibody for WB, ELISA

Cat No. 60966-4-Ig

Clone No.2D8E10

Host / Isotype

Mouse / IgG2b

Reactivity

human, rat, pig

Applications

WB, ELISA

Synonyms

FHL 3, FHL-3, Four and a half LIM domains protein 3, Skeletal muscle LIM-protein 2, SLIM2

---

Tested Applications

• Positive WB detected in: HUVEC cells, Mo7e cells, pig skeletal muscle tissue, HeLa cells, K-562 cells, Kasumi-1 cells, rat skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60966-4-Ig targets FHL3 in WB, ELISA applications and shows reactivity with human, rat, pig samples.

• Tested Reactivity: human, rat, pig
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1495

  Product name: Recombinant human FHL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-280 aa of BC011697

  Sequence: MSESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP

• Full Name: four and a half LIM domains 3
• Calculated Molecular Weight: 31 kDa
• Observed Molecular Weight: 30-34 kDa
• GenBank Accession Number: BC011697
• Gene Symbol: FHL3
• Gene ID (NCBI): 2275
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13643
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Four and a half LIM domain (FHL) protein 3 is a member of the FHL protein family that has roles in the regulation of signal transduction, survival, cell adhesion, and mobility. It also involves in the development and progression of liver cancer. The FHL proteins have been shown to regulate a variety of transcription factors, including SMAD proteins, β-catenin, SRF, AP-1, NFAT, FOXO1, MyoD, and the androgen receptor. Beside, the FHL proteins may involve in muscle growth and differentiation. Recent research revealed FHL3 was a PCBP2 target, also involved in the growth and induced apoptosis of glioma cell (23585479).