FILIP1L Polyclonal antibody, PBS Only

• 

  WB analysis using 30134-1-AP (same clone as 30134-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30134-1-AP (FILIP1L antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30134-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse ovary using 30134-1-AP (same clone as 30134-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 30134-1-AP (FILIP1L antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30134-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse ovary using 30134-1-AP (same clone as 30134-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 30134-1-AP (FILIP1L antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30134-1-PBS in a different storage buffer formulation.

FILIP1L Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 30134-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

30134-1-PBS targets FILIP1L in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32655

  Product name: Recombinant human FILIP1L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 566-661 aa of BC027860

  Sequence: DNEPPDYKSLIPLERAVINGQLYEESENQDEDPNDEGSVLSFKCSQSTPCPVNRKLWIPWMKSKEGHLQNGKMQTKPNANFVQPGDLVLSHTPGQP

• Full Name: filamin A interacting protein 1-like
• Calculated Molecular Weight: 893 aa, 102 kDa
• Observed Molecular Weight: 100-110 kDa
• GenBank Accession Number: BC027860
• Gene Symbol: FILIP1L
• Gene ID (NCBI): 11259
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q4L180
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.