FIS1 Monoclonal antibody

• 

  WB analysis using 66635-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66635-1-Ig (FIS1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 66635-1-Ig

  Various cells were subjected to SDS PAGE followed by western blot with 66635-1-Ig (FIS1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 66635-1-Ig

  IP result of anti-FIS1 (IP:66635-1-Ig, 4ug; Detection:66635-1-Ig 1:1000) with HeLa cells lysate 1120 ug.

• 

  IHC staining of human breast cancer using 66635-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66635-1-Ig (FIS1 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 66635-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66635-1-Ig (FIS1 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 66635-1-Ig

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66635-1-Ig (FIS1 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 66635-1-Ig

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66635-1-Ig (FIS1 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 66635-1-Ig

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 66635-1-Ig (FIS1 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 66635-1-Ig

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 66635-1-Ig (FIS1 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 66635-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using FIS1 antibody (66635-1-Ig, Clone: 2F10E1 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002), CL594-Phalloidin (red).

FIS1 Monoclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 66635-1-Ig

Clone No.2F10E1

Publications(27)

Reviews (2)

Host / Isotype

Mouse / IgG1

Reactivity

human and More (5)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

TPR repeat protein 11, hFis1, FIS1 homolog, CGI-135, CGI 135

---

Tested Applications

• Positive WB detected in: LNCaP cells, HEK-293 cells, HeLa cells, MCF-7 cells, Jurkat cells, HepG2 cells, K-562 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human breast cancer tissue, human prostate cancer tissue, human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 19 publications below
• IHC: See 1 publications below
• IF: See 3 publications below

Product Information

66635-1-Ig targets FIS1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat, pig, goat, fish
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1409

  Product name: Recombinant human FIS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-152 aa of BC009428

  Sequence: MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS

• Full Name: fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC009428
• Gene Symbol: FIS1
• Gene ID (NCBI): 51024
• RRID: AB_2881994
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9Y3D6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fis1 (fission 1) is an integral mitochondrial outer membrane protein that participates in mitochondrial fission by interacting with dynamin-related protein 1 (Drp1). Excessive mitochondrial fission is associated with the pathology of a number of neurodegenerative or neurodevelopmental diseases. Increased expression of Fis1 has been found in Huntington's disease (HD)-affected brain, Alzheimer's disease (AD) patients, and autism spectrum disorder. (21257639, 21459773, 23333625)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Pineal Res; Melatonin and verteporfin synergistically suppress the growth and stemness of head and neck squamous cell carcinoma through the regulation of mitochondrial dynamics; Authors - Ye Young Shin
mouse		Environ Pollut; Disturbance of Mitochondrial Dynamics Led to Spermatogenesis Disorder in Mice Exposed to Polystyrene Micro- and Nanoplastics; Authors - Moxuan Zhao
human		EMBO Rep; Nup358 restricts ER-mitochondria connectivity by modulating mTORC2/Akt/GSK3β signalling; Authors - Misha Kalarikkal
pig	IF	J Cell Physiol; DMT1 Maintains Iron Homeostasis to Regulate Mitochondrial Function in Porcine Oocytes; Authors - Jin-Xin Zhang
mouse	WB	Front Immunol; Metformin Modulates T Cell Function and Alleviates Liver Injury Through Bioenergetic Regulation in Viral Hepatitis.; Authors - Lanman Xu
fish	WB	J Physiol Sci; Cardioprotective responses to aerobic exercise-induced physiological hypertrophy in zebrafish heart; Authors - Zhanglin Chen

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Pierre (Verified Customer) (09-26-2025)

Very Good

• Applications: Western Blot
• Cell Tissue Type: T cells

FH

Chun (Verified Customer) (06-19-2022)

This antibody worked very well.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1,000
• Cell Tissue Type: HeLa cells and HEK293 cells