FLYWCH2 Polyclonal antibody, PBS Only

• 

  IHC staining of human thyroid cancer using 24228-1-AP (same clone as 24228-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 24228-1-AP (FLYWCH2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24228-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human thyroid cancer using 24228-1-AP (same clone as 24228-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 24228-1-AP (FLYWCH2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24228-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 24228-1-AP (same clone as 24228-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 24228-1-AP (FLYWCH2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24228-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 24228-1-AP (same clone as 24228-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 24228-1-AP (FLYWCH2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24228-1-PBS in a different storage buffer formulation.

FLYWCH2 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 24228-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

24228-1-PBS targets FLYWCH2 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21577

  Product name: Recombinant human FLYWCH2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 50-140 aa of BC014089

  Sequence: DSTKVAGAKRKGVHCVMSLGVPGPATLAKALLQTHPEAQRAIEAAPQEPEQKRSRQDPGTDRTEDSGLAAGPPEAAGENFAPCSVAPGKSL

• Full Name: FLYWCH family member 2
• Calculated Molecular Weight: 140 aa, 15 kDa
• GenBank Accession Number: BC014089
• Gene Symbol: FLYWCH2
• Gene ID (NCBI): 114984
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q96CP2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FLYWCH2 (FLYWCH Family Member 2) is a Protein Coding gene.