FNDC3B Polyclonal antibody

• 

  WB analysis of 4T1 using 22605-1-AP

  4T1 cells were subjected to SDS PAGE followed by western blot with 22605-1-AP (FNDC3B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of C6 using 22605-1-AP

  C6 cells were subjected to SDS PAGE followed by western blot with 22605-1-AP (FNDC3B antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HL-60 using 22605-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 22605-1-AP (FNDC3B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 22605-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 22605-1-AP (FNDC3B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 22605-1-AP

  IP result of anti-FNDC3B (IP:22605-1-AP, 4ug; Detection:22605-1-AP 1:1000) with HepG2 cells lysate 2400ug.

• 

  IHC staining of human liver using 22605-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 22605-1-AP (FNDC3B Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human liver using 22605-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 22605-1-AP (FNDC3B Antibody) at dilution of 1:200 (under 40x lens).

• Featured Product
• KD/KO Validated

FNDC3B Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 22605-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

FAD104, fibronectin type III domain containing 3B, Fibronectin type III domain-containing protein 3B, HCV NS5A-binding protein 37, UNQ2421/PRO4979/PRO34274

---

Tested Applications

• Positive WB detected in: 4T1 cells, HL-60 cells, HepG2 cells, C6 cells
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 9 publications below
• IHC: See 3 publications below
• IF: See 1 publications below

Product Information

22605-1-AP targets FNDC3B in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18357

  Product name: Recombinant human FNDC3B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 3-370 aa of BC039297

  Sequence: VTMMMTDQIPLELPPLLNGEVAMMPHLVNGDAAQQVILVQVNPGETFTIRAEDGTLQCIQGPAEVPMMSPNGSIPPIHVPPGYISQVIEDSTGVRRVVVTPQSPECYPPSYPSAMSPTHHLPPYLTHHPHFIHNSHTAYYPPVTGPGDMPPQFFPQHHLPHTIYGEQEIIPFYGMSSYITREDQYSKPPHKKLKDRQIDRQNRLNSPPSSIYKSSCTTVYNGYGKGHSGGSGGGGSGSGPGIKKTERRARSSPKSNDSDLQEYELEVKRVQDILSGIEKPQVSNIQARAVVLSWAPPVGLSCGPHSGLSFPYSYEVALSDKGRDGKYKIIYSGEELECNLKDLRPATDYHVRVYAMYNSVKGSCSEPV

• Full Name: fibronectin type III domain containing 3B
• Calculated Molecular Weight: 1204 aa, 133 kDa
• Observed Molecular Weight: 150 kDa, 70 kDa
• GenBank Accession Number: BC039297
• Gene Symbol: FNDC3B
• Gene ID (NCBI): 64778
• RRID: AB_2879133
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q53EP0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fibronectin type III domain-containing protein 3B(FNDC3B), also named FAD104, belongs to the FNDC3 family. NDC3B is a positive regulator of adipocyte differentiation and is expressed at an early stage of adipocyte differentiation. FNDC3B is an endoplasmic reticulum transmembrane protein with a single transmembrane domain at the C terminus preceded by nine repeated fibronectin type III domains(PMID: 32966780). Due to the ability of the fibronectin type III domain to bind to a variety of proteins, FNDC3B plays a crucial role in cell adhesion, proliferation, and growth signaling. FNDC3B is abnormally expressed in a variety of human cancers, including hepatocellular carcinoma, acute myeloid leukemia, colorectal carcinoma, and cervical carcinoma(PMID: 36275754).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC,IF	Cancer Sci; FNDC3B 3'-UTR shortening escapes from microRNA-mediated gene repression and promotes nasopharyngeal carcinoma progression.; Authors - Ying-Qing Li ; KD Validated
human	WB	Pediatr Res; Hirschsprung's disease: key microRNAs and target genes.; Authors - Mei Hong
human	WB	Cancers (Basel); Integrated Analysis of RNA-Binding Proteins in Glioma.; Authors - Zhixing Wang
human	WB	J Cell Physiol; FNDC3B circular RNA promotes the migration and invasion of gastric cancer cells via the regulation of E-cadherin and CD44 expression.; Authors - Yuling Hong
human	WB,IHC	Am J Transl Res; EYA1 promotes cell migration and tumor metastasis in hepatocellular carcinoma.; Authors - Deguang Kong
human	WB	J Cell Commun Signal; CircRNA hsa_circ_0001627 aggravates cervical cancer progression through upregulation of FNDC3B and activating PI3K/mTOR signaling pathway; Authors - Yan Li