Product Information
29338-1-PBS targets FOXK1 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28820 Product name: Recombinant human FOXK1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of NM_001037165 Sequence: MAEVGEDSGARALLALRSAPCSPVLCAAAAAAAFPAAAPPPAPAQPQPPPGPPPPPPPPLPPGAIAGAGSSGGSSGVSGDSAVAGAAPALVAAAAASVRQ Predict reactive species |
| Full Name | forkhead box K1 |
| Calculated Molecular Weight | 75 kDa |
| Observed Molecular Weight | 90-100 kDa |
| GenBank Accession Number | NM_001037165 |
| Gene Symbol | FOXK1 |
| Gene ID (NCBI) | 221937 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P85037 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Forkhead box (FOX) domains bind DNA and consist of 2 loops connecting beta-sheets that flank an alpha-helix, which is a group of highly conserved transcription factors. Forkhead box k1 (FOXK1) also known as MNF, is a transcription factor that belongs to the forkhead family consisting of the winged-helix DNA-binding domain and the N-terminal and C-terminal transcriptional domains(PMID: 15289879, PMID: 27223064). There are two isoforms of FoxK1: FoxK1-α and FoxK1-β. FoxK1-α (90 kDa) is expressed in committed myoblasts and differentiated myotubes, while FoxK1-β (55 kDa) is expressed mainly in quiescent satellite cells(PMID: 9271401).











