Tested Applications
| Positive WB detected in | DU 145 cells, HEK-293T cells, HepG2 cells, SGC-7901 cells, mouse brain tissue, rat brain tissue, mouse kidney tissue |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | Daudi cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 8 publications below |
| WB | See 167 publications below |
| IHC | See 17 publications below |
| IF | See 28 publications below |
| IP | See 4 publications below |
| ChIP | See 5 publications below |
| RIP | See 1 publications below |
Product Information
18592-1-AP targets FOXO1 in WB, IHC, IF/ICC, FC (Intra), IP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, bovine, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13296 Product name: Recombinant human FOXO1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 301-655 aa of BC021981 Sequence: SHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG Predict reactive species |
| Full Name | forkhead box O1 |
| Calculated Molecular Weight | 655 aa, 70 kDa |
| Observed Molecular Weight | 70-80 kDa |
| GenBank Accession Number | BC021981 |
| Gene Symbol | FOXO1 |
| Gene ID (NCBI) | 2308 |
| RRID | AB_10860103 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q12778 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FOXO1, also named as FOXO1A, FKHR and FKH1, is a member of the FOXO subfamily of Forkhead transcription factors. FOXO1 is a transcription factor which acts as a regulator of cell responses to oxidative stress. FOXO1 interacts with LRPPRC and SIRT1. In the presence of KIRT1, FOXO1 mediates down-regulation of cyclin D1 and up-regulation of CDKN1B levels which are required for cell transition from proliferative growth to quiescence. FOXO1 contains three predicted protein kinase B phosphorylation sites (Thr-24, Ser-256, and Ser-319) that are conserved in other FOXO proteins. The t(2;13) and the variant t(1;13) translocations generate PAX3/FKHR and PAX7/FKHR fusion proteins respectively. The resulting protein is a transcriptional activator. Defects in FOXO1 are a cause of rhabdomyosarcoma type 2 (RMS2).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for FOXO1 antibody 18592-1-AP | Download protocol |
| IF protocol for FOXO1 antibody 18592-1-AP | Download protocol |
| IHC protocol for FOXO1 antibody 18592-1-AP | Download protocol |
| IP protocol for FOXO1 antibody 18592-1-AP | Download protocol |
| WB protocol for FOXO1 antibody 18592-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Exp Med PD-1 and TIM-3 differentially regulate subsets of mouse IL-17A–producing γδ T cells | ||
Cell Res Blocking FSH inhibits hepatic cholesterol biosynthesis and reduces serum cholesterol. | ||
Dev Cell DDX20 is required for cell-cycle reentry of prospermatogonia and establishment of spermatogonial stem cell pool during testicular development in mice | ||
Redox Biol miR-484 mediates oxidative stress-induced ovarian dysfunction and promotes granulosa cell apoptosis via SESN2 downregulation | ||
Aging Cell Activation of angiotensin-converting enzyme 2/angiotensin (1-7)/mas receptor axis triggers autophagy and suppresses microglia proinflammatory polarization via forkhead box class O1 signaling | ||
Toxicology Toxicity mechanism of peri-implantation pesticide beta-cypermethrin exposure on endometrial remodeling in early pregnant mice |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH MALLIKARJUNA (Verified Customer) (11-07-2025) | GOOD FOR WESTERN
|
FH Hala (Verified Customer) (01-27-2023) | an specific band is observed around 20 KDa
![]() |
FH Ruchi (Verified Customer) (07-08-2022) | I used the free sample antibody for immunofluorescence and I am happy with the results. I would like to order Proteintech products for my lab needs
![]() |











