• Featured Product
  • KD/KO Validated

FOXO1 Monoclonal antibody

FOXO1 Monoclonal Antibody for WB, IHC, ELISA
Cat No. 66457-1-Ig
Clone No.1D9A2

Host / Isotype

Mouse / IgG1

Reactivity

human and More (2)

Applications

WB, IHC, IF, CoIP, ELISA

1D9A2, FKH 1, FKH1, FKHR, forkhead box O1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, SMMC-7721 cells, HEK-293 cells, HepG2 cells, L02 cells
Positive IHC detected inhuman cervical cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66457-1-Ig targets FOXO1 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, goat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag13296

Product name: Recombinant human FOXO1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 301-655 aa of BC021981

Sequence: SHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG

Predict reactive species
Full Name forkhead box O1
Calculated Molecular Weight 655 aa, 70 kDa
Observed Molecular Weight 68-70 kDa
GenBank Accession NumberBC021981
Gene Symbol FOXO1
Gene ID (NCBI) 2308
RRIDAB_2881826
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ12778
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FOXO1, also named as FOXO1A, FKHR and FKH1, is a member of the FOXO subfamily of Forkhead transcription factors. FOXO1 is a transcription factor which acts as a regulator of cell responses to oxidative stress. FOXO1 interacts with LRPPRC and SIRT1. In the presence of KIRT1, FOXO1 mediates down-regulation of cyclin D1 and up-regulation of CDKN1B levels which are required for cell transition from proliferative growth to quiescence. FOXO1 contains three predicted protein kinase B phosphorylation sites (Thr-24, Ser-256, and Ser-319) that are conserved in other FOXO proteins. The t(2;13) and the variant t(1;13) translocations generate PAX3/FKHR and PAX7/FKHR fusion proteins respectively. The resulting protein is a transcriptional activator. Defects in FOXO1 are a cause of rhabdomyosarcoma type 2 (RMS2).

Protocols

Product Specific Protocols
WB protocol for FOXO1 antibody 66457-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Transl Psychiatry

Psychosocial and behavioral problems of children and adolescents in the early stage of reopening schools after the COVID-19 pandemic: a national cross-sectional study in China.

Authors - Lin Wang
humanWB

Int J Biol Sci

ATIC inhibits autophagy in hepatocellular cancer through the AKT/FOXO3 pathway and serves as a prognostic signature for modeling patient survival.

Authors - Hao Zhang
humanWB

Int Immunopharmacol

1β-Hydroxyalantolactone from Inulae Flos alleviated the progression of pulmonary fibrosis via inhibiting JNK/FOXO1/NF-κB pathway

Authors - Bing Yu
humanWB

Thorac Cancer

Serum exosomal miR-1269a serves as a diagnostic marker and plays an oncogenic role in non-small cell lung cancer.

Authors - Xue Wang
  • KD Validated
WB

Equine Vet J

Muscle fibre transition and transcriptional changes of horse skeletal muscles during traditional Mongolian endurance training

Authors - Tugeqin Bou
mouseWB

Ecotoxicol Environ Saf

Integrated network toxicology, molecular docking, and in vivo experiments to elucidate molecular mechanism of aflatoxin B1 hepatotoxicity

Authors - Bingjie Ge

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Refik (Verified Customer) (09-07-2025)

Works well with overnight incubation with 1:250 in 1x PBST with 5% BSA for ICC staining of human-derived cells with 3 hours at RTP with 1:400 secondary antibody in 1x PBST with 5% Donkey Serum and DAPI

  • Applications: Western Blot, Immunohistochemistry
  • Primary Antibody Dilution: 1:250 for ICC staining of human-derived cells with 1:400 secondary antibody
  • Cell Tissue Type: Human-derived cardiac cells
Loading...
||
New chat Able
正在加载,请稍候...