Tested Applications
| Positive WB detected in | HeLa cells, SMMC-7721 cells, HEK-293 cells, HepG2 cells, L02 cells |
| Positive IHC detected in | human cervical cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66457-1-Ig targets FOXO1 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, goat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13296 Product name: Recombinant human FOXO1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 301-655 aa of BC021981 Sequence: SHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG Predict reactive species |
| Full Name | forkhead box O1 |
| Calculated Molecular Weight | 655 aa, 70 kDa |
| Observed Molecular Weight | 68-70 kDa |
| GenBank Accession Number | BC021981 |
| Gene Symbol | FOXO1 |
| Gene ID (NCBI) | 2308 |
| RRID | AB_2881826 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q12778 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FOXO1, also named as FOXO1A, FKHR and FKH1, is a member of the FOXO subfamily of Forkhead transcription factors. FOXO1 is a transcription factor which acts as a regulator of cell responses to oxidative stress. FOXO1 interacts with LRPPRC and SIRT1. In the presence of KIRT1, FOXO1 mediates down-regulation of cyclin D1 and up-regulation of CDKN1B levels which are required for cell transition from proliferative growth to quiescence. FOXO1 contains three predicted protein kinase B phosphorylation sites (Thr-24, Ser-256, and Ser-319) that are conserved in other FOXO proteins. The t(2;13) and the variant t(1;13) translocations generate PAX3/FKHR and PAX7/FKHR fusion proteins respectively. The resulting protein is a transcriptional activator. Defects in FOXO1 are a cause of rhabdomyosarcoma type 2 (RMS2).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for FOXO1 antibody 66457-1-Ig | Download protocol |
| WB protocol for FOXO1 antibody 66457-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The FOXO1 Monoclonal antibody (catalog #66457-1-Ig) has 17 citations in total. Notable journals include Metabolism, Redox Biol, Acta Pharm Sin B, Cell Death Dis, Int J Biol Sci, J Pineal Res, Transl Psychiatry, Ecotoxicol Environ Saf, Biochem Pharmacol, Int Immunopharmacol, Front Nutr, Cell Signal, Endocrinology, Genomics, Thorac Cancer, and Equine Vet J. Research fields span muscle atrophy/sarcopenia, cardiovascular calcification, cholesterol/lipid metabolism, prostate cancer and ferroptosis, hepatocellular carcinoma/autophagy, diabetic retinopathy, hepatotoxicity, type 2 diabetes, pulmonary fibrosis, hepatic gluconeogenesis, endometrial decidualization, milk lipid synthesis, and non-small cell lung cancer.
| Species | Application | Title |
|---|---|---|
Metabolism Anti-sarcopenic effects of active vitamin D through modulation of anabolic and catabolic signaling pathways in human skeletal muscle: A randomized controlled trial | ||
Redox Biol FOXO1 regulates RUNX2 ubiquitination through SMURF2 in calcific aortic valve disease | ||
Acta Pharm Sin B IMM-H007 promotes hepatic cholesterol and triglyceride metabolism by activating AMPKα to attenuate hypercholesterolemia. | ||
Cell Death Dis SGK2 promotes prostate cancer metastasis by inhibiting ferroptosis via upregulating GPX4
| ||
Int J Biol Sci ATIC inhibits autophagy in hepatocellular cancer through the AKT/FOXO3 pathway and serves as a prognostic signature for modeling patient survival. | ||
J Pineal Res Melatonin Attenuates Diabetic Retinopathy by Regulating EndMT of Retinal Vascular Endothelial Cells via Inhibiting the HDAC7/FOXO1/ZEB1 Axis |
Reviews
What customers say
Able is busy answering your previous question. Please try again later.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Refik (Verified Customer) (09-07-2025) | Works well with overnight incubation with 1:250 in 1x PBST with 5% BSA for ICC staining of human-derived cells with 3 hours at RTP with 1:400 secondary antibody in 1x PBST with 5% Donkey Serum and DAPI
|
