Tested Applications
Positive WB detected in | Caco-2 cells, PC-3 cells |
Positive IHC detected in | mouse ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
29311-1-AP targets FOXP4 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse samples.
Tested Reactivity | Human, Mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag29953 Product name: Recombinant human FOXP4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 560-678 aa of BC052803 Sequence: ISGLSYGALNASYQAALAESSFPLLNSPGMLNPGSASSLLPLSHDDVGAPVEPLPSNGSSSPPRLSPPQYSHQVQVKEEPAEAEEDRQPGPPLGAPNPSASGPPEDRDLEEELPGEELS Predict reactive species |
Full Name | forkhead box P4 |
Calculated Molecular Weight | 678 aa, 73 kDa |
Observed Molecular Weight | 73 kDa |
GenBank Accession Number | BC052803 |
Gene Symbol | FOXP4 |
Gene ID (NCBI) | 116113 |
RRID | AB_2918279 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8IVH2 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FOXP4, also named as FKHLA, belongs to the FOX family. FOXP4 has been implicated in diverse biological processes in tumor initiation and progression. It has been demonstrated that FOXP4 is significantly upregulated in breast cancer, hepatocellular carcinoma and oral squamous cell carcinoma (PMID: 34590150). FOXP4 has 3 isoforms with the molecular mass of 72-73 kDa.
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for FOXP4 antibody 29311-1-AP | Download protocol |
WB protocol for FOXP4 antibody 29311-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |