Product Information
84579-3-PBS targets FPR2 in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag34304 Product name: Recombinant human FPR2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 300-350 aa of BC029125 Sequence: MLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQA Predict reactive species |
| Full Name | formyl peptide receptor 2 |
| Calculated Molecular Weight | 351 aa, 39 kDa |
| GenBank Accession Number | BC029125 |
| Gene Symbol | FPR2 |
| Gene ID (NCBI) | 2358 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P25090 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
