• Featured Product
  • KD/KO Validated

Follistatin Monoclonal antibody

Follistatin Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 60060-1-Ig
Clone No.4E9B10

Host / Isotype

Mouse / IgG2b

Reactivity

human and More (3)

Applications

WB, IHC, IF/ICC, ELISA

FST, FS, Activin-binding protein, Activin binding protein, 4E9B10

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, Raji cells, U2OS cells, SKOV-3 cells, A549 cells, NCI-H1299 cells, Calu-3 cells
Positive IHC detected inhuman ovary tumor tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60060-1-Ig targets Follistatin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat, camel
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0775

Product name: Recombinant human FST protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-344 aa of BC004107

Sequence: MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW

Predict reactive species
Full Name follistatin
Calculated Molecular Weight 33 aa, 7 kDa
Observed Molecular Weight 35 kDa
GenBank Accession NumberBC004107
Gene Symbol Follistatin
Gene ID (NCBI) 10468
RRIDAB_2106706
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP19883
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Follistatin (FST) is a member of the tissue growth factor β family and is a secreted glycoprotein that antagonizes many members of the family, including activin A, growth differentiation factor11 , and myostatin. It binds activin A with high affinity and whose expression can be induced by activin A and several other pro-inflammatory cytokines. Activin A-follistatin complexes are biologically inactive and bind to cell surface heparan sulphate-containing proteoglycans for internalisation and degradation. It has also been found to play a significant role in the management of skeletal muscle size and mass. It also has important roles in early embryonic development, differentiation of ovarian granulosa cells, liver fibrosis and polycystic ovarian syndrome. FS 288 glycosylation results in a major species of 35 kDa and a less abundant 40 kDa and minor products of 40 and 42 kDa (PMID: 9785474). Three typical follistatin bands are at 32, 35, and 39 kDa (PMID: 2036994).

Protocols

Product Specific Protocols
WB protocol for Follistatin antibody 60060-1-IgDownload protocol
IHC protocol for Follistatin antibody 60060-1-IgDownload protocol
IF protocol for Follistatin antibody 60060-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
ratIHC

Cells

Tubule-Derived Follistatin Is Increased in the Urine of Rats with Renal Ischemia and Reflects the Severity of Acute Tubular Damage

Authors - Izumi Nagayama
mouseIHC

Antioxid Redox Signal

Follistatin Protects against Glomerular Mesangial Cell Apoptosis and Oxidative Stress to Ameliorate Chronic Kidney Disease.

Authors - Neel Mehta
mouseWB

Front Pharmacol

Follistatin Attenuates Myocardial Fibrosis in Diabetic Cardiomyopathy via the TGF-β-Smad3 Pathway.

Authors - Yinhui Wang
humanIF

Fertil Steril

Myostatin, follistatin and activin type II receptors are highly expressed in adenomyosis.

Authors - Patrizia Carrarelli
human,mouseWB,IF

PeerJ

Development of a gene doping detection method to detect overexpressed human follistatin using an adenovirus vector in mice.

Authors - Koki Yanazawa
camelWB,IF

Animals (Basel)

Screening and Identification of Differential Ovarian Proteins before and after Induced Ovulation via Seminal Plasma in Bactrian Camels.

Authors - Qi Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Jennifer (Verified Customer) (07-17-2023)

I am not sure what this antibody targets, but I am sure it is not Follistatin. This is a glycosylated protein that appears as a smear at ~40 - 50 kDa. However, with this antibody there is a single band at ~ 35 kDa. We have validated several FST antibodies using knock-down and overexpression cell lines so we know what to expect.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5,000
  • Cell Tissue Type: HNSCC cell lines
Loading...
||
New chat Able
正在加载,请稍候...