Filter: AllWBIHCIF-PFC (Intra)

WB analysis using 27226-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 27226-1-AP (FTO antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
WB analysis of MDA-MB-231 using 27226-1-AP
WB result of FTO antibody (27226-1-AP; 1:10000; room temperature for 1.5 hours) with wild-type and FTO knockout MDA-MB-231 cells.
WB analysis using 27226-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 27226-1-AP (FTO antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.
IHC staining of human liver cancer using 27226-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 27226-1-AP (FTO antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human liver cancer using 27226-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 27226-1-AP (FTO antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human stomach cancer using 27226-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 27226-1-AP (FTO antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human stomach cancer using 27226-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 27226-1-AP (FTO antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human breast cancer using 27226-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 27226-1-AP (FTO antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human breast cancer using 27226-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 27226-1-AP (FTO antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human colon using 27226-1-AP
Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27226-1-AP (FTO antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human colon using 27226-1-AP
Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27226-1-AP (FTO antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human liver cancer using 27226-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 27226-1-AP (FTO antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human liver cancer using 27226-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 27226-1-AP (FTO antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IF Staining of human lymphoma using 27226-1-AP
Immunofluorescent analysis of (4% PFA) fixed human lymphoma tissue using FTO antibody (27226-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
IF Staining of human lymphoma using 27226-1-AP
Immunofluorescent analysis of (4% PFA) fixed human lymphoma tissue using FTO antibody (27226-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
IF Staining of human liver cancer using 27226-1-AP
Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using FTO antibody (27226-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
IF Staining of human liver cancer using 27226-1-AP
Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using FTO antibody (27226-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
FC experiment of SH-SY5Y using 27226-1-AP
1X10^6 SH-SY5Y cells were intracellularly stained with 0.4 ug Anti-Human FTO (27226-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

Featured Product
KD/KO Validated

FTO Polyclonal antibody

FTO Polyclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA

Cat No. 27226-1-AP

Publications(210)

Reviews (5)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (5)

Applications

WB, IHC, IF-P, FC (Intra), IP, CoIP, RIP, ELISA

Synonyms

KIAA1752

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (210)
Protocols
Reviews (5)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	A549 cells, MDA-MB-231 cells, Caco-2 cells, HEK-293 cells, HeLa cells, HEK-293T cells, SH-SY5Y cells
Positive IHC detected in	human liver cancer tissue, human breast cancer tissue, human colon tissue, human stomach cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF-P detected in	human lymphoma tissue, human liver cancer tissue
Positive FC (Intra) detected in	SH-SY5Y cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:3000
Immunohistochemistry (IHC)	IHC : 1:200-1:800
Immunofluorescence (IF)-P	IF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)	FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

KD/KO	See 26 publications below
WB	See 186 publications below
IHC	See 43 publications below
IF	See 21 publications below
IP	See 3 publications below
CoIP	See 4 publications below
RIP	See 18 publications below

Product Information

27226-1-AP targets FTO in WB, IHC, IF-P, FC (Intra), IP, CoIP, RIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Cited Reactivity	human, mouse, rat, pig, chicken, goat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag26095 Product name: Recombinant human FTO protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 400-505 aa of NM_001080432 Sequence: MAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMPLPFDLTDIVSELRGQLLEAKP Predict reactive species
Full Name	fat mass and obesity associated
Calculated Molecular Weight	58 kDa
Observed Molecular Weight	58 kDa
GenBank Accession Number	NM_001080432
Gene Symbol	FTO
Gene ID (NCBI)	79068
RRID	AB_2880809
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9C0B1
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fat mass and obesity-associated protein (FTO) has efficient oxidative demethylation activity targeting the abundant N6-methyladenosine (m6A) residues in RNA in vitro. Variants in the FTO (fat mass and obesity associated) gene are associated with increased body mass index in humans.

Protocols

Product Specific Protocols
IF protocol for FTO antibody 27226-1-AP	Download protocol
IHC protocol for FTO antibody 27226-1-AP	Download protocol
WB protocol for FTO antibody 27226-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
human	WB	Nature A druggable copper-signalling pathway that drives inflammation Authors - Stéphanie Solier View Article
human	WB	Nat Genet N6-Methyladenosine co-transcriptionally directs the demethylation of histone H3K9me2. Authors - Yuan Li KO Validated View Article
mouse	WB,RIP	Nat Cell Biol The piRNA CHAPIR regulates cardiac hypertrophy by controlling METTL3-dependent N6-methyladenosine methylation of Parp10 mRNA. Authors - Xiang-Qian Gao View Article
mouse,human	WB,IP	Nat Commun Overcoming therapeutic resistance in oncolytic herpes virotherapy by targeting IGF2BP3-induced NETosis in malignant glioma Authors - Weiwei Dai View Article
human	WB	Mol Cell mTORC1 stimulates cell growth through SAM synthesis and m6A mRNA-dependent control of protein synthesis. Authors - Elodie Villa View Article
mouse	WB	Adv Sci (Weinh) PXR Activation Relieves Deoxynivalenol-Induced Liver Oxidative Stress Via Malat1 LncRNA m6A Demethylation Authors - Yue Feng View Article

Reviews

Add a review

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

FH Xiaochen (Verified Customer) (07-08-2024)	Show good sepecific image in WB without non-specific bend. Applications: Western Blot Cell Tissue Type: U2OS FTO Antibody Western Blot validation ( dilution) in U2OS (Cat no:27226-1-AP)
FH Katherine (Verified Customer) (09-25-2023)	Quality was good. Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: HEK293T
FH S (Verified Customer) (03-20-2023)	Very Good Applications: Western Blot Primary Antibody Dilution: 1000 Cell Tissue Type: AC16 FTO Antibody Western Blot validation (1000 dilution) in AC16 (Cat no:27226-1-AP)
FH SU (Verified Customer) (03-22-2022)	Applications: Western Blot Cell Tissue Type: H9C2 FTO Antibody Western Blot validation ( dilution) in H9C2 (Cat no:27226-1-AP)
FH P. (Verified Customer) (05-15-2021)	Excellent antibody! Applications: Western Blot Cell Tissue Type: H9C2 FTO Antibody Western Blot validation ( dilution) in H9C2 (Cat no:27226-1-AP)