FTSJ3 Polyclonal antibody

• 

  WB analysis using 16609-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16609-1-AP (FTSJ3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 16609-1-AP

  WB result of FTSJ3 antibody (16609-1-AP; 1:120000; incubated at room temperature for 1.5 hours) with sh-Control and sh-FTSJ3 transfected MCF-7 cells.

• Featured Product
• KD/KO Validated

FTSJ3 Polyclonal Antibody for WB, ELISA

Cat No. 16609-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

EC:2.1.1.-, EPCS3, FTSJ 3, pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3, SB92

---

Tested Applications

• Positive WB detected in: A549 cells, MCF-7 cells, SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16609-1-AP targets FTSJ3 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9835

  Product name: Recombinant human FTSJ3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 491-847 aa of BC036710

  Sequence: KRMRLTEVQDDKEEEEEENPLLVPLEEKAVLQEEQANLWFSKGSFAGIEDDADEALEISQAQLLFENRRKGRQQQQKQQLPQTPPSCLKTEIMSPLYQDEAPKGTEASSGTEAATGLEGEEKDGISDSDSSTSSEEEESWEPLRGKKRSRGPKSDDDGFEIVPIEDPAKHRILDPEGLALGAVIASSKKAKRDLIDNSFNRYTFNEDEGELPEWFVQEEKQHRIRQLPVGKKEVEHYRKRWREINARPIKKVAEAKARKKRRMLKRLEQTRKKAEAVVNTVDISEREKVAQLRSLYKKAGLGKEKRHVTYVVAKKGVGRKVRRPAGVRGHFKVVDSRMKKDQRAQQRKEQKKKHKRK

• Full Name: FtsJ homolog 3 (E. coli)
• Calculated Molecular Weight: 847 aa, 97 kDa
• Observed Molecular Weight: 120-130 kDa
• GenBank Accession Number: BC036710
• Gene Symbol: FTSJ3
• Gene ID (NCBI): 117246
• RRID: AB_3669252
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IY81
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FTSJ3 is an RNA 2'-O-methyltransferase recruited by HIV to avoid innate immune sensing.