Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, SH-SY5Y cells, mouse brain tissue, rat brain tissue |
| Positive IP detected in | K-562 cells |
| Positive IHC detected in | rat brain tissue, human breast cancer tissue, human ovary tumor tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse colon tissue, mouse liver tissue |
| Positive IF-Fro detected in | rat brain tissue |
| Positive IF/ICC detected in | HepG2 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11570-1-AP targets FUS/TLS in WB, IHC, IF/ICC, IF-P, IF-Fro, IP, CoIP, chIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, chicken, yeast |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2150 Product name: Recombinant human FUS/TLS protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 53-400 aa of BC026062 Sequence: SSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGG Predict reactive species |
| Full Name | fusion (involved in t(12;16) in malignant liposarcoma) |
| Calculated Molecular Weight | 75 kDa |
| Observed Molecular Weight | 68-75 kDa |
| GenBank Accession Number | BC026062 |
| Gene Symbol | FUS/TLS |
| Gene ID (NCBI) | 2521 |
| RRID | AB_2247082 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P35637 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FUS (also named TLS and POMp75) belongs to the RRM TET family. FUS may play a role in the maintenance of genomic integrity; it binds both single-stranded and double-stranded DNA and promotes ATP-independent annealing of complementary single-stranded DNAs and D-loop formation in superhelical double-stranded DNA. FUS is also an RNA-binding protein, and its links to neurodegenerative disease proffer the intriguing possibility that altered RNA metabolism or RNA processing may underlie or contribute to neuron degeneration[PMID: 22640227]. FUS may be a cause of angiomatoid fibrous histiocytoma (AFH) and is implicated in certain forms of amyotrophic lateral sclerosis (ALS) and frontotemporal dementias (FTDs) such as frontotemporal lobar dementia with ubiquitin inclusions (FTLD-U) (PMID: 22640227). This antibody is a rabbit polyclonal antibody raised against an internal region of human FUS. FUS aggregates are composed of different isoforms or fragments of various sizes, rather than only the main isoform. Bands of smaller or larger sizes (35 kDa, 75 kDa, and the gel top bands) were detected in P2h, and bands around 135 kDa and 245 kDa in S2h could be FUS oligomers (PMID: 35289333).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for FUS/TLS antibody 11570-1-AP | Download protocol |
| IHC protocol for FUS/TLS antibody 11570-1-AP | Download protocol |
| IP protocol for FUS/TLS antibody 11570-1-AP | Download protocol |
| WB protocol for FUS/TLS antibody 11570-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Lancet Antisense oligonucleotide jacifusen for FUS-ALS: an investigator-initiated, multicentre, open-label case series | ||
Nature Mutations in UBQLN2 cause dominant X-linked juvenile and adult-onset ALS and ALS/dementia. | ||
Nat Med Antisense oligonucleotide silencing of FUS expression as a therapeutic approach in amyotrophic lateral sclerosis. | ||
Cell Nuclear-Import Receptors Reverse Aberrant Phase Transitions of RNA-Binding Proteins with Prion-like Domains. |
Reviews
What customers say
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Manon (Verified Customer) (01-26-2026) | Good staining into the nucleus of FUS on fibroblast
|
Sonam (Verified Customer) (10-16-2025) | Good Ab
|
Xiaochen (Verified Customer) (07-08-2024) | Sensitivie for IF and show image with good quelity.
![]() |
Xhuljana (Verified Customer) (03-01-2024) | Used in siRNA transfected C2C12 cells
![]() |
Zhongwen (Verified Customer) (09-25-2023) | I can find two bands in the target region. I am not sure which one is the target band.
![]() |
manohar (Verified Customer) (07-10-2023) | Nitrocellulose membrane is used with 5% milk as blocking and antibody diluted in 1% milk and incubated overnight.
|
Tatyana (Verified Customer) (05-14-2023) | ICC using 5% goat serum/PBST buffer, 2 hours at RT. Good specific nuclear signal.
![]() |
shashirekha (Verified Customer) (12-23-2020) | Used for immunopreciptation at 1:1000 dilution. Works very well
![]() |
H (Verified Customer) (04-06-2020) | The antibody worked well for HCT116 cell line. Nuclear cytosolic fractionation clearly showed that FUS is dominantly in nucleus, and sub-fraction is present in cytosol.
![]() |
Karthik (Verified Customer) (04-24-2019) | Magenta- FUSBlue- MAP2FUS staining consistent obtained with this antibody is consistent with literature
|
Yen-Chen (Verified Customer) (12-03-2018) |
|





















































