• Featured Product
  • KD/KO Validated

FUS/TLS Polyclonal antibody

FUS/TLS Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IF-Fro, IP, ELISA
Cat No. 11570-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IF-P, IF-Fro, IP, CoIP, ChIP, RIP, ELISA

FUS, 75 kDa DNA pairing protein, 75 kDa DNA-pairing protein, ALS, ALS6

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, SH-SY5Y cells, mouse brain tissue, rat brain tissue
Positive IP detected inK-562 cells
Positive IHC detected inmouse brain tissue, human ovary tumor tissue, rat brain tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse colon tissue, mouse liver tissue
Positive IF-Fro detected inrat brain tissue
Positive IF/ICC detected inHepG2 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)-FROIF-FRO : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11570-1-AP targets FUS/TLS in WB, IHC, IF/ICC, IF-P, IF-Fro, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, chicken
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2150

Product name: Recombinant human FUS/TLS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 53-400 aa of BC026062

Sequence: SSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGG

Predict reactive species
Full Name fusion (involved in t(12;16) in malignant liposarcoma)
Calculated Molecular Weight 75 kDa
Observed Molecular Weight 68-75 kDa
GenBank Accession NumberBC026062
Gene Symbol FUS/TLS
Gene ID (NCBI) 2521
RRIDAB_2247082
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP35637
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FUS (also named TLS and POMp75) belongs to the RRM TET family. FUS may play a role in the maintenance of genomic integrity; it binds both single-stranded and double-stranded DNA and promotes ATP-independent annealing of complementary single-stranded DNAs and D-loop formation in superhelical double-stranded DNA. FUS is also an RNA-binding protein, and its links to neurodegenerative disease proffer the intriguing possibility that altered RNA metabolism or RNA processing may underlie or contribute to neuron degeneration[PMID: 22640227]. FUS may be a cause of angiomatoid fibrous histiocytoma (AFH) and is implicated in certain forms of amyotrophic lateral sclerosis (ALS) and frontotemporal dementias (FTDs) such as frontotemporal lobar dementia with ubiquitin inclusions (FTLD-U) (PMID: 22640227). This antibody is a rabbit polyclonal antibody raised against an internal region of human FUS. FUS aggregates are composed of different isoforms or fragments of various sizes, rather than only the main isoform. Bands of smaller or larger sizes (35 kDa, 75 kDa, and the gel top bands) were detected in P2h, and bands around 135 kDa and 245 kDa in S2h could be FUS oligomers (PMID: 35289333).

Protocols

Product Specific Protocols
IF protocol for FUS/TLS antibody 11570-1-APDownload protocol
IHC protocol for FUS/TLS antibody 11570-1-APDownload protocol
IP protocol for FUS/TLS antibody 11570-1-APDownload protocol
WB protocol for FUS/TLS antibody 11570-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

Lancet

Antisense oligonucleotide jacifusen for FUS-ALS: an investigator-initiated, multicentre, open-label case series

Authors - Neil A Shneider
mouseIHC

Nature

Divergent transcriptional regulation of astrocyte reactivity across disorders.

Authors - Joshua E Burda
humanIHC,IF

Nature

Mutations in UBQLN2 cause dominant X-linked juvenile and adult-onset ALS and ALS/dementia.

Authors - Deng Han-Xiang HX
mouse,humanWB

Nat Med

Antisense oligonucleotide silencing of FUS expression as a therapeutic approach in amyotrophic lateral sclerosis.

Authors - Vladislav A Korobeynikov
humanWB,IF

Cell

Nuclear-Import Receptors Reverse Aberrant Phase Transitions of RNA-Binding Proteins with Prion-like Domains.

Authors - Lin Guo
humanWB

Cell Metab

NEAT1 is essential for metabolic changes that promote breast cancer growth and metastasis.

Authors - Mi Kyung Park

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Manon (Verified Customer) (01-26-2026)

Good staining into the nucleus of FUS on fibroblast

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1/100
  • Cell Tissue Type: Fibroblasts
FH

Sonam (Verified Customer) (10-16-2025)

Good Ab

  • Applications: Western Blot
  • Cell Tissue Type: Macrophages
FH

Xiaochen (Verified Customer) (07-08-2024)

Sensitivie for IF and show image with good quelity.

  • Applications: Immunofluorescence
  • Cell Tissue Type: U2OS
FUS/TLS Antibody Immunofluorescence validation ( dilution) in U2OS (Cat no:11570-1-AP)
FH

Xhuljana (Verified Customer) (03-01-2024)

Used in siRNA transfected C2C12 cells

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: C2C12 cells
FUS/TLS Antibody Western Blot validation (1:1000 dilution) in C2C12 cells (Cat no:11570-1-AP)
FH

Zhongwen (Verified Customer) (09-25-2023)

I can find two bands in the target region. I am not sure which one is the target band.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293T
FUS/TLS Antibody Western Blot validation (1:1000 dilution) in HEK293T (Cat no:11570-1-AP)
FH

manohar (Verified Customer) (07-10-2023)

Nitrocellulose membrane is used with 5% milk as blocking and antibody diluted in 1% milk and incubated overnight.

  • Applications: Western Blot, Immunofluorescence, Immunoprecipitation
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293, Neuronal stem cells, Mouse tissue
FH

Tatyana (Verified Customer) (05-14-2023)

ICC using 5% goat serum/PBST buffer, 2 hours at RT. Good specific nuclear signal.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HeLa
FUS/TLS Antibody Immunofluorescence validation (1:1000 dilution) in HeLa (Cat no:11570-1-AP)
FH

shashirekha (Verified Customer) (12-23-2020)

Used for immunopreciptation at 1:1000 dilution. Works very well

  • Applications: Immunoprecipitation
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Rat cortical neurons
FUS/TLS Antibody Immunoprecipitation validation (1:1000 dilution) in Rat cortical neurons (Cat no:11570-1-AP)
FH

H (Verified Customer) (04-06-2020)

The antibody worked well for HCT116 cell line. Nuclear cytosolic fractionation clearly showed that FUS is dominantly in nucleus, and sub-fraction is present in cytosol.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: HCT116
FUS/TLS Antibody Western Blot validation (1:2000 dilution) in HCT116 (Cat no:11570-1-AP)
FH

Karthik (Verified Customer) (04-24-2019)

Magenta- FUSBlue- MAP2FUS staining consistent obtained with this antibody is consistent with literature

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:250 overnight at 4 degrees
  • Cell Tissue Type: motor neurons
FH

Yen-Chen (Verified Customer) (12-03-2018)

  • Applications: Western Blot, Immunofluorescence,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: human motor neuron
Loading...
||
New chat

Able

正在加载,请稍候...