CoraLite®488-conjugated FUS/TLS Polyclonal antibody

• 

  IF Staining of HepG2 using CL488-11570

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite®488 FUS/TLS antibody (CL488-11570) at dilution of 1:200.

• 

  IF Staining of HepG2 using CL488-11570

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite®488 FUS/TLS antibody (CL488-11570) at dilution of 1:200.

• 

  IF Staining of HeLa using CL488-11570

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite®488 FUS/TLS antibody (CL488-11570) at dilution of 1:200, CoraLite®594 TDP-43 (C-terminal) antibody (CL594-12892, red).

• 

  FC experiment of MCF-7 using CL488-11570

  1X10^6 MCF-7 cells were intracellularly stained with 0.2 ug CoraLite®488 Anti-Human FUS/TLS (CL488-11570) (red), or 0.2 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• Featured Product
• KD/KO Validated

FUS/TLS Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-11570

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Synonyms

FUS, FUS1, ALS6, ALS, 75 kDa DNA-pairing protein

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells, HeLa cells
• Positive FC (Intra) detected in: MCF-7 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-11570 targets FUS/TLS in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2150

  Product name: Recombinant human FUS/TLS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 53-400 aa of BC026062

  Sequence: SSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGG

• Full Name: fusion (involved in t(12;16) in malignant liposarcoma)
• Calculated Molecular Weight: 75 kDa
• GenBank Accession Number: BC026062
• Gene Symbol: FUS/TLS
• Gene ID (NCBI): 2521
• RRID: AB_2883079
• Conjugate: CoraLite®488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 491 nm / 516 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35637
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

FUS (also named TLS and POMp75) belongs to the RRM TET family. FUS may play a role in the maintenance of genomic integrity; it binds both single-stranded and double-stranded DNA and promotes ATP-independent annealing of complementary single-stranded DNAs and D-loop formation in superhelical double-stranded DNA. FUS is also an RNA-binding protein, and its links to neurodegenerative disease proffer the intriguing possibility that altered RNA metabolism or RNA processing may underlie or contribute to neuron degeneration[PMID: 22640227]. FUS may be a cause of angiomatoid fibrous histiocytoma (AFH) and is implicated in certain forms of amyotrophic lateral sclerosis (ALS) and frontotemporal dementias (FTDs) such as frontotemporal lobar dementia with ubiquitin inclusions (FTLD-U)[PMID: 22640227]. This antibody is a rabbit polyclonal antibody raised against an internal region of human FUS. This antibody is conjugated with CL488, Ex/Em 488 nm/515 nm.