FXYD3 Polyclonal antibody

• 

  WB analysis of COLO 320 using 15853-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 15853-1-AP (FXYD3 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A375 using 15853-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 15853-1-AP (FXYD3 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SGC-7901 using 15853-1-AP

  SGC-7901 cells were subjected to SDS PAGE followed by western blot with 15853-1-AP (FXYD3 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  IP experiment of COLO 320 using 15853-1-AP

  IP result of anti-FXYD3 (IP:15853-1-AP, 4ug; Detection:15853-1-AP 1:500) with COLO 320 cells lysate 2400ug.

• 

  IHC staining of human breast cancer using 15853-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15853-1-AP (FXYD3 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 15853-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15853-1-AP (FXYD3 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 15853-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 15853-1-AP (FXYD3 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 15853-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 15853-1-AP (FXYD3 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 15853-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 15853-1-AP (FXYD3 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

FXYD3 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 15853-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

Chloride conductance inducer protein Mat-8, FXYD domain-containing ion transport regulator 3, Mammary tumor 8 kDa protein, MAT 8, MAT8

---

Tested Applications

• Positive WB detected in: COLO 320 cells, A375 cells, SGC-7901 cells
• Positive IP detected in: COLO 320 cells
• Positive IHC detected in: human breast cancer tissue, human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15853-1-AP targets FXYD3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8672

  Product name: Recombinant human FXYD3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-87 aa of BC005238

  Sequence: MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSGHHPGETPPLITPGSAQS

• Full Name: FXYD domain containing ion transport regulator 3
• Calculated Molecular Weight: 87 aa, 9 kDa
• Observed Molecular Weight: 8 kDa
• GenBank Accession Number: BC005238
• Gene Symbol: FXYD3
• Gene ID (NCBI): 5349
• RRID: AB_2108602
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14802
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FXYD3 (also known as Mat-8) is one of the seven members of Fxyd3 protein family, belonging to a small molecular auxiliary subunit with single transmembrane, and its extracellular segment contains conservative Fxyd3 sequence motifs. By combining the α/β catalytic core of Na/K-ATPase, this family can finely adjust the ionic affinity and kinetics of the pump in different tissues, cell types and physiological states, without affecting the overall expression of the enzyme. It is mainly expressed in stomach, colon, pancreas, prostate, skin and other epithelium, showing obvious tissue specificity, and is significantly up-regulated in breast cancer, pancreatic cancer, colorectal cancer, prostate cancer, renal cell cancer, cholangiocarcinoma and psoriasis lesions, and is related to disease progression and chemotherapy resistance.