Tested Applications
Positive WB detected in | COLO 320 cells, A375 cells, SGC-7901 cells |
Positive IP detected in | COLO 320 cells |
Positive IHC detected in | human breast cancer tissue, human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
15853-1-AP targets FXYD3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag8672 Product name: Recombinant human FXYD3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-87 aa of BC005238 Sequence: MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSGHHPGETPPLITPGSAQS Predict reactive species |
Full Name | FXYD domain containing ion transport regulator 3 |
Calculated Molecular Weight | 87 aa, 9 kDa |
Observed Molecular Weight | 8 kDa |
GenBank Accession Number | BC005238 |
Gene Symbol | FXYD3 |
Gene ID (NCBI) | 5349 |
RRID | AB_2108602 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q14802 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for FXYD3 antibody 15853-1-AP | Download protocol |
IHC protocol for FXYD3 antibody 15853-1-AP | Download protocol |
IP protocol for FXYD3 antibody 15853-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |