Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Dysadherin Polyclonal antibody

Dysadherin Polyclonal Antibody for WB, IHC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, ELISA

dysad, Dysadherin, FXYD5, HSPC113, IWU 1, IWU1, KCT1, OIT2, PRO6241, RIC, UNQ2561/PRO6241

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Dysadherin in ?

Tested Applications

Positive WB detected inmouse small intestine tissue, human placenta tissue
Positive IHC detected inhuman kidney tissue, human cervical cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2400
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12166-1-AP targets Dysadherin in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2808

Product name: Recombinant human FXYD5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 25-178 aa of BC009642

Sequence: KDTTSSSSADSTIMDIQVPTRAPDAVYTELQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLRKRGLLVAAVLFITGIIILTSGKCRQLSRLCRNHCR

Predict reactive species
Full Name FXYD domain containing ion transport regulator 5
Calculated Molecular Weight 178 aa, 19 kDa
Observed Molecular Weight 24 kDa
GenBank Accession NumberBC009642
Gene Symbol Dysadherin
Gene ID (NCBI) 53827
RRIDAB_10640583
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96DB9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Dysadherin, also known as FXYD5 (FXYD domain containing ion transport regulator 5), is a cancer-associated cell membrane glycoprotein which belongs to the FXYD family. The FXYD family, which contains seven members, are tissue specific regulators of the Na,K-ATPase. Dysadherin is involved in down-regulation of E-cadherin, which plays important roles in tumor development and metastasis. It is present in spleen, lung, skeletal muscle, and testis. Increased expression of dysadherin has been associated with increased cell motility and metastatic potential.

Protocols

Product Specific Protocols
IHC protocol for Dysadherin antibody 12166-1-APDownload protocol
WB protocol for Dysadherin antibody 12166-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-FXYD5 antibody (Cat# 12166-1-AP) has 11 total citations appearing in journals including Int J Oncol, Cancer Gene Ther, iScience, Cell Transplant, Exp Cell Res, Biochimie, Mol Biotechnol, J Dev Biol, Bioengineered, Transpl Immunol, and Oncol Rep. Associated research fields span ovarian, gastric, pancreatic, kidney, and thyroid cancers, glioblastoma, hematopoietic development, pancreatitis, and cardiac ischemia/reperfusion injury.

SpeciesApplicationTitle

Int J Oncol

A FXYD5/TGF‑β/SMAD positive feedback loop drives epithelial‑to‑mesenchymal transition and promotes tumor growth and metastasis in ovarian cancer.

Authors - Yang Bai
humanWB,IHC

Cancer Gene Ther

FXYD5 regulates gastric cancer cell metastasis and drug resistance by EMT modulation

Authors - Yuning Mao
  • KD Validated

iScience

Identification of FXYD5 as an oncogene in pediatric papillary thyroid cancer.

Authors - Ju Yu
humanWB,IHC

Cell Transplant

Development and Clinical Validation of a Seven-Gene Prognostic Signature Based on Multiple Machine Learning Algorithms in Kidney Cancer.

Authors - Mi Tian

Exp Cell Res

USP11 stabilizes RALY to promote FXYD5-mediated aerobic glycolysis and aggravate pancreatic cancer progression

Authors - Hongmin Xie
humanWB

Biochimie

Generation of the novel anti-FXYD5 monoclonal antibody and its application to the diagnosis of pancreatic and lung cancer

Authors - Takamasa Hotta
  • KO Validated

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The product has one user review. The reviewer used the antibody for Western Blot on kidney tissue at a 1:1000 dilution and gave it a 5-star rating, noting that it works well for WB applications.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Uthra (Verified Customer) (10-02-2026)

Good for WB

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Kidney
Loading...
||
New chat

Able™

正在加载,请稍候...