Product Information
84110-2-PBS targets Fas/CD95 in Cytometric bead array, Indirect ELISA applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg1376 Product name: Recombinant Mouse Fas/CD95 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-169 aa of NM_007987.2 Sequence: QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNR Predict reactive species |
| Full Name | Fas (TNF receptor superfamily member 6) |
| Calculated Molecular Weight | 37kDa |
| GenBank Accession Number | NM_007987.2 |
| Gene Symbol | Fas/CD95 |
| Gene ID (NCBI) | 14102 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P25446 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
