Fibulin-7 Polyclonal antibody, PBS Only

Fibulin-7 Polyclonal Antibody for WB, Indirect ELISA
Cat No. 21136-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, pig

Applications

WB, Indirect ELISA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

21136-1-PBS targets Fibulin-7 in WB, Indirect ELISA applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag15564

Product name: Recombinant human FBLN7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 90-439 aa of BC035784

Sequence: GRKFGSKYLVDHEVHFTCNPGFRLVGPSSVVCLPNGTWTGEQPHCRGISECSSQPCQNGGTCVEGVNQYRCICPPGRTGNRCQHQAQTAAPEGSVAGDSAFSRAPRCAQVERAQHCSCEAGFHLSGAAGDSVCQDVNECELYGQEGRPRLCMHACVNTPGSYRCTCPGGYRTLADGKSCEDVDECVGLQPVCPQGTTCINTGGSFQCVSPECPEGSGNVSYVKTSPFQCERNPCPMDSRPCRHLPKTISFHYLSLPSNLKTPITLFRMATASAPGRAGPNSLRFGIVGGNSRGHFVMQRSDRQTGDLILVQNLEGPQTLEVDVDMSEYLDRSFQANHVSKVTIFVSPYDF

Predict reactive species
Full Name fibulin 7
Calculated Molecular Weight 439 aa, 47 kDa
Observed Molecular Weight47 kDa
GenBank Accession NumberBC035784
Gene Symbol Fibulin-7
Gene ID (NCBI) 129804
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen Affinity purified
UNIPROT IDQ53RD9
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Fibulins are a family of extracellular matrix glycoproteins associated with basement membranes, elastic fibers, and other matrices (PMID: 19189051). The family members are defined by the presence of two structural modules, a tandem repeat of epidermal growth factor-like modules, and a unique C-terminal fibulin-type module (PMID: 19189051). They play an important role in regulating multiple cellular functions such as adhesion, growth, motility, and survival (PMID: 32429873). Fibulin-7, also named as TM14, was first identified in the mouse tooth germ cDNA microarray by differential hybridization (PMID: 17699513). Fibulin-7 is expressed in developing odontoblasts, in the giant trophoblast layer of the placenta, in the choroid of the eyes as well as in the cartilage (PMID: 32429873). It plays important roles in both the differentiation and maintenance of odontoblasts as well as in dentin formation.

Loading...
||
New chat Able
正在加载,请稍候...