Tested Applications
| Positive WB detected in | MCF-7 cells, HeLa cells, THP-1 cells, T-47D cells |
| Positive IHC detected in | human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27729-1-AP targets Flightless I in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26865 Product name: Recombinant human FLII protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 440-900 aa of BC025300 Sequence: DQAKQVLKGMSDVAQEKNKKQEESADARAPSGKVRRWDQGLEKPRLDYSEFFTEDVGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGSLNWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDISYIEGGTASGFYTVEDTHYVTRMYRVYGKKNIKLEPVPLKGTSLDPRFVFLLDRGLDIYVWRGAQATLSSTTKARLFAEKINKNERKGKAEITLLVQGQELPEFWEALGGEPSEIKKHVPEDFWPPQPKLYKVGLGLGYLELPQINYKLSVEHKQRPKVELMPRMRLLQSLLDTRCVYILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHATVSRSLEGTEAQVFKAKFKNWDDVLTVDYTRNAEAVLQSPGLSGKVKRDAEKKDQMKADLTALFLPRQPPMSLAEAEQLMEEW Predict reactive species |
| Full Name | flightless I homolog (Drosophila) |
| Calculated Molecular Weight | 1269 aa, 145 kDa |
| Observed Molecular Weight | 145-150 kDa |
| GenBank Accession Number | BC025300 |
| Gene Symbol | Flightless I |
| Gene ID (NCBI) | 2314 |
| RRID | AB_3085990 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13045 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Flightless I (FliI) is the most evolutionarily conserved member of the gelsolin superfamily of proteins which are key regulators of actin filament assembly and turnover. FliI comprises an N-terminal leucine-rich repeat (LRR) domain which is not present in other gelsolin family members, and the LRR domain may enable interactions between FliI and other molecules involved in signal transduction, thereby spatially integrating signaling and actin remodeling functions. This protein was originally found in Drosophila and participates in the embryonic development, while mammalian FliI protein was involved in the regulation of wound repair,skin barrier development. Studies recently demonstrated that FliI protein associated with colorectal cancer, hepatocellular and prostate cancer (PMID:30091651; 28498392).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Flightless I antibody 27729-1-AP | Download protocol |
| IHC protocol for Flightless I antibody 27729-1-AP | Download protocol |
| WB protocol for Flightless I antibody 27729-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









