Mouse Foxp3 Recombinant monoclonal antibody, PBS Only

• 

Foxp3 Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 85128-4-PBS

Clone No.242674B10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

Indirect ELISA

Synonyms

242674B10, forkhead box P3, Forkhead box protein P3 41 kDa form, Forkhead box protein P3, C-terminally processed, JM2

---

Product Information

85128-4-PBS targets Foxp3 in Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4360

  Product name: Recombinant Mouse Foxp3 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 10007378 of

  Sequence: YPLLANGVCKWPGCEKVFEEPEEFLKHCQADHLLDEKGKAQCLLQREVVQSLEQQLELEKEKLGAMQAHLAGKMALAKAPS

• Full Name: forkhead box P3
• Observed Molecular Weight: 45 kDa
• Gene Symbol: Foxp3
• Gene ID (NCBI): 20371
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q99JB6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FOXP3, also named as IPEX, JM2 and Scurfin, is a transcription factor. FOXP3 plays a critical role in the control of immune response. Defects in FOXP3 are the cause of immunodeficiency polyendocrinopathy, enteropathy, X-linked syndrome (IPEX) which also known as X-linked autoimmunity-immunodeficiency syndrome.