G6PC Polyclonal antibody, PBS Only

• 

  WB analysis using 29084-1-AP (same clone as 29084-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29084-1-AP (G6PC antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29084-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse liver using 29084-1-AP (same clone as 29084-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse liver tissue using G6PC antibody (29084-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29084-1-PBS in a different storage buffer formulation.

G6PC Polyclonal Antibody for WB, IF-P, Indirect ELISA

Cat No. 29084-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF-P, Indirect ELISA

Synonyms

G6PC1, EC:3.1.3.9, G6Pase, G-6-Pase, G6Pase-alpha

---

Product Information

29084-1-PBS targets G6PC in WB, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30614

  Product name: Recombinant human G6PC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 72-121 aa of BC130478

  Sequence: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM

• Full Name: glucose-6-phosphatase, catalytic subunit
• Calculated Molecular Weight: 357 aa, 40 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC130478
• Gene Symbol: G6PC
• Gene ID (NCBI): 2538
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35575
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Glucose-6-phosphatase-α (G6PC) is a key enzyme in glucose homeostasis that catalyzes the hydrolysis of glucose-6-phosphate to glucose and phosphate in the terminal step of gluconeogenesis and glycogenolysis. G6PC activity is restricted to the liver , the kidney cortex and the small intestine and confers on these three organs the capacity to release glucose into the systemic circulation (PMID: 21983240).The encoded enzyme is anchored to the ER by nine transmembrane helices with the amino (N)-terminus in the lumen and the carboxyl (C)-terminus in the cytoplasm (PMID: 15542400).