GAB2 Polyclonal antibody, PBS Only

• 

  WB analysis using 29272-1-AP (same clone as 29272-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 29272-1-AP (GAB2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29272-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 29272-1-AP (same clone as 29272-1-PBS)

  WB result of GAB2 antibody (29272-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-GAB2 transfected K-562 cells. This data was developed using the same antibody clone with 29272-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 29272-1-AP (same clone as 29272-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 29272-1-AP (GAB2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29272-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 29272-1-AP (same clone as 29272-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 29272-1-AP (GAB2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29272-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 29272-1-AP (same clone as 29272-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 29272-1-AP (GAB2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29272-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 29272-1-AP (same clone as 29272-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 29272-1-AP (GAB2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29272-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

GAB2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29272-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

29272-1-PBS targets GAB2 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30347

  Product name: Recombinant human GAB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 588-676 aa of BC131711

  Sequence: QNPVSASPVPSGTNSPAPKKSTGSVDYLALDFQPSSPSPHRKPSTSSVTSDEKVDYVQVDKEKTQALQNTMQEWTDVRQSSEPSKGAKL

• Full Name: GRB2-associated binding protein 2
• Calculated Molecular Weight: 676 aa, 74 kDa
• Observed Molecular Weight: 74-90 kDa
• GenBank Accession Number: BC131711
• Gene Symbol: GAB2
• Gene ID (NCBI): 9846
• RRID: AB_2918265
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UQC2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Growth factor receptor-bound protein 2 (GAB2), an adaptor protein, belongs to the Gab family and is involved in various biologic processes. Gab2 mainly mediates phosphatidylinositol 3-kinase (PI3K) and extracellular signal-regulated kinase (ERK) signaling pathways. Furthermore, Gab2 governs tumorigenic signaling and is a novel potential therapeutic target in leukemia, breast cancer, ovarian cancer, and melanoma. Gab2 is the major 98-kDa phosphoprotein associated with SHP-2, PI 3-kinase, and Grb2 in normal human lymphocytes. (PMID: 32269703, PMID: 28842424, PMID: 28420432, PMID: 10849428)