GABRG1 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse eye using 12871-1-AP (same clone as 12871-1-PBS)

  mouse eye tissue were subjected to SDS PAGE followed by western blot with 12871-1-AP (GABRG1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12871-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 12871-1-AP (same clone as 12871-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas using 12871-1-AP (GABRG1 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 12871-1-PBS in a different storage buffer formulation.

GABRG1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12871-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

12871-1-PBS targets GABRG1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3535

  Product name: Recombinant human GABRG1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 39-272 aa of BC031087

  Sequence: ADDEDDEDLTVNKTWVLAPKIHEGDITQILNSLLQGYDNKLRPDIGVRPTVIETDVYVNSIGPVDPINMEYTIDIIFAQTWFDSRLKFNSTMKVLMLNSNMVGKIWIPDTFFRNSRKSDAHWITTPNRLLRIWNDGRVLYTLRLTINAECYLQLHNFPMDEHSCPLEFSSYGYPKNEIEYKWKKPSVEVADPKYWRLYQFAFVGLRNSTEITHTISGDYVIMTIFFDLSRRMGY

• Full Name: gamma-aminobutyric acid (GABA) A receptor, gamma 1
• Calculated Molecular Weight: 465 aa, 54 kDa
• Observed Molecular Weight: 54 kDa
• GenBank Accession Number: BC031087
• Gene Symbol: GABRG1
• Gene ID (NCBI): 2565
• RRID: AB_2107274
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N1C3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.