GAL3ST4 Polyclonal antibody

• 

  WB analysis of human placenta using 16240-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 16240-1-AP (GAL3ST4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A2780 using 16240-1-AP

  A2780 cells were subjected to SDS PAGE followed by western blot with 16240-1-AP (GAL3ST4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse thymus using 16240-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 16240-1-AP (GAL3ST4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

GAL3ST4 Polyclonal Antibody for WB, ELISA

Cat No. 16240-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

GAL3ST 4, GAL3ST4

---

Tested Applications

• Positive WB detected in: human placenta tissue, A2780 cells, mouse thymus tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16240-1-AP targets GAL3ST4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9063

  Product name: Recombinant human GAL3ST4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 136-486 aa of BC012976

  Sequence: HMRFNLKEVLQVMPSDSFFFSIVRDPAALARSAFSYYKSTSSAFRKSPSLAAFLANPRGFYRPGARGDHYARNLLWFDFGLPFPPEKRAKRGNIHPPRDPNPPQLQVLPSGAGPRAQTLNPNALIHPVSTVTDHRSQISSPASFDLGSSSFIQWGLAWLDSVFDLVMVAEYFDESLVLLADALCWGLDDVVGFMHNAQAGHKQGLSTVSNSGLTAEDRQLTARARAWNNLDWALYVHFNRSLWARIEKYGQGRLQTAVAELRARREALAKHCLVGGEASDPKYITDRRFRPFQFGSAKVLGYILRSGLSPQDQEECERLATPELQYKDKLDVKQFPPTVSLPLKTSRPLSP

• Full Name: galactose-3-O-sulfotransferase 4
• Calculated Molecular Weight: 486 aa, 54 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC012976
• Gene Symbol: GAL3ST4
• Gene ID (NCBI): 79690
• RRID: AB_2294471
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96RP7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.