GALK1 Polyclonal antibody, PBS Only

• 

  WB analysis using 15284-1-AP (same clone as 15284-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15284-1-AP (GALK1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15284-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 15284-1-AP (same clone as 15284-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 15284-1-AP (GALK1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15284-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 15284-1-AP (same clone as 15284-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15284-1-AP (GALK1 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15284-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

GALK1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15284-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

EC:2.7.1.6, GALK, GK1

---

Product Information

15284-1-PBS targets GALK1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7403

  Product name: Recombinant human GALK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-392 aa of BC001166

  Sequence: MAALRQPQVAELLAEARRAFREEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELMTVLVGSPRKDGLVSLLTTSEGADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAAPLPGFSAVVVSSVPLGGGLSSSASLEVATYTFLQQLCPDSGTIAARAQVCQQAEHSFAGMPCGIMDQFISLMGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLASSEYPVRRRQCEEVARALGKESLREVQLEELEAARDLVSKEGFRRARHVVGEIRRTAQAAAALRRGDYRAFGRLMVESHRSLRDDYEVSCPELDQLVEAALAVPGVYGSRMTGGGFGGCTVTLLEASAAPHAMRHIQEHYGGTATFYLSQAADGAKVLCL

• Full Name: galactokinase 1
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC001166
• Gene Symbol: GALK1
• Gene ID (NCBI): 2584
• RRID: AB_2108553
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P51570
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GALK1, also named as GALK, belongs to the GHMP kinase family and GalK subfamily. GALK1, located on chromosome 17q24, encodes galactokinase and is involved in galactose metabolism (PMID: 32807972). The molecular weight of GALK1 is 42 kDa.