GANC Polyclonal antibody, PBS Only

• 

  WB analysis using 31163-1-AP (same clone as 31163-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31163-1-AP (GANC antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31163-1-PBS in a different storage buffer formulation.

GANC Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31163-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

EC:3.2.1.20, glucosidase, alpha; neutral C, Neutral alpha-glucosidase C

---

Product Information

31163-1-PBS targets GANC in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35067

  Product name: Recombinant human GANC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 50-210 aa of BC059406

  Sequence: VTTDEDSTRFQIINEASKVPLLAEIYGIEGNIFRLKINEETPLKPRFEVPDVLTSKPSTVRLISCSGDTGSLILADGKGDLKCHITANPFKVDLVSEEEVVISINSLGQLYFEHLQILHKQRAAKENEEETSVDTSQENQEDLGLWEEKFGKFVDIKANGP

• Full Name: glucosidase, alpha; neutral C
• Calculated Molecular Weight: 104 kDa
• Observed Molecular Weight: 100-105 kDa
• GenBank Accession Number: BC059406
• Gene Symbol: GANC
• Gene ID (NCBI): 2595
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8TET4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GANC (Glucosidase Alpha, Neutral C) is a Protein Coding gene. Diseases associated with GANC include Pompe Disease and Autosomal Recessive Limb-Girdle Muscular Dystrophy Type 2A.