GATSL2 Polyclonal antibody

• 

  WB analysis of rat brain using 22843-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 22843-1-AP (GATSL2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

GATSL2 Polyclonal Antibody for WB, ELISA

Cat No. 22843-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, Rat

Applications

WB, ELISA

Synonyms

GATS like protein 2, GATSL2

---

Tested Applications

• Positive WB detected in: rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22843-1-AP targets GATSL2 in WB, ELISA applications and shows reactivity with human, Rat samples.

• Tested Reactivity: human, Rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18791

  Product name: Recombinant human GATSL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 137-257 aa of BC147030

  Sequence: HTLSSEFTILRVVNGETVAAENLGITNGFVKPKLVQRPVIHPLSSPSNRFCVTSLDPDTLPAVATLLMDVMFYSNGVKDPMATGDDCGHIRFFSFSLIEGYISLVMDVQTQQRFPSNLLFT

• Full Name: GATS-like protein 2
• Calculated Molecular Weight: 329 aa, 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC147030
• Gene Symbol: GATSL2
• Gene ID (NCBI): 729438
• RRID: AB_3085703
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: A6NHX0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GATSL2,also named CASTOR2, lacks an arginine-binding capacity and is constitutively associated with GATOR2 complex, resulting in persistent mTORC1 inactivation.