GBP3 Polyclonal antibody

• 

  WB analysis using 30719-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30719-1-AP (GBP3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse cerebellum using 30719-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 30719-1-AP (GBP3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 30719-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 30719-1-AP (GBP3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 30719-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 30719-1-AP (GBP3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 30719-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 30719-1-AP (GBP3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

GBP3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 30719-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

Guanine nucleotide-binding protein 3, GTP-binding protein 3, GTP binding protein 3, GBP-3, GBP 3

---

Tested Applications

• Positive WB detected in: HUVEC cells
• Positive IHC detected in: mouse cerebellum tissue, mouse lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30719-1-AP targets GBP3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33889

  Product name: Recombinant human GBP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 535-595 aa of BC140837

  Sequence: RERAQLLEEQEKTLTSKLQEQARVLKERCQGESTQLQNEIQKLQKTLKKKTKRYMSHKLKI*

• Full Name: guanylate binding protein 3
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC140837
• Gene Symbol: GBP3
• Gene ID (NCBI): 2635
• RRID: AB_3086400
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H0R5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Guanylate-binding protein 3 (GBP3) is involved in the proliferation of glioma cells through regulating SQSTM1-ERK1/2 pathway. GBP3 has 2 isoforms, one is 595 amino acids long at 68 kDa and the other is at nearly 62 kDa.