GCGR Polyclonal antibody

• 

  WB analysis of mouse liver using 26784-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 26784-1-AP (GCGR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 26784-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 26784-1-AP (GCGR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 26784-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 26784-1-AP (GCGR antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human liver using 26784-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 26784-1-AP (GCGR antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human skeletal muscle using 26784-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 26784-1-AP (GCGR antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human skeletal muscle using 26784-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 26784-1-AP (GCGR antibody) at dilution of 1:200 (under 40x lens).

GCGR Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26784-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ELISA

Synonyms

glucagon receptor, GL-R, GL R, GGR

---

Tested Applications

• Positive WB detected in: mouse liver tissue, mouse heart tissue
• Positive IHC detected in: human liver tissue, human skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 6 publications below
• IHC: See 1 publications below
• IF: See 2 publications below

Product Information

26784-1-AP targets GCGR in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24861

  Product name: Recombinant human GCGR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 91-141 aa of BC104854

  Sequence: VQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKMYSSF

• Full Name: glucagon receptor
• Calculated Molecular Weight: 477 aa, 54 kDa
• Observed Molecular Weight: 62-68 kDa
• GenBank Accession Number: BC104854
• Gene Symbol: GCGR
• Gene ID (NCBI): 2642
• RRID: AB_2880634
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P47871
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glucagon receptor (GCGR) is a secretin-like (class B) family of G-protein coupled receptors (GPCRs). It plays an important role in elevating the glucose concentration in the blood and has thus become one of the promising therapeutic targets for treating type 2 diabetes mellitus (PMID: 26236379). GCGR is a 62-kDa glycoprotein that contains at least four N-linked oligosaccharide chains (PMID: 2174441; 15245877). Defects in the gene of GCGR cause non-insulin-dependent diabetes mellitus (NIDDM).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	iScience; Pro-α-cell-derived β-cells contribute to β-cell neogenesis induced by antagonistic glucagon receptor antibody in type 2 diabetic mice.; Authors - Xiaona Cui
		J Gastroenterol Hepatol; Irisin Alleviates Impaired Mitochondrial Fusion via Enhancing PKA/SIRT3/mTOR Pathway in Hepatic Steatosis; Authors - Jia Li
mouse	WB	Mol Cell Endocrinol; Mof acetyltransferase inhibition ameliorates glucose intolerance and islet dysfunction of type 2 diabetes via targeting pancreatic α-cells.; Authors - Xinghong Guo
mouse	WB	Toxicology; Tributyltin exposure disturbs hepatic glucose metabolism in male mice.; Authors - Jing Xu
mouse	WB,IF	Am J Physiol Endocrinol Metab; Glucagon receptor blockage inhibits β-cell dedifferentiation through FoxO1; Authors - Kangli Wang
mouse	IHC,WB	Biomed Pharmacother; Si-Miao-Yong-An decoction preserves cardiac function and regulates GLC/AMPK/NF-κB and GLC/PPARα/PGC-1α pathways in diabetic mice; Authors - Lin Li